BLASTX nr result
ID: Angelica22_contig00024036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024036 (737 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531626.1| conserved hypothetical protein [Ricinus comm... 63 6e-08 >ref|XP_002531626.1| conserved hypothetical protein [Ricinus communis] gi|223528744|gb|EEF30754.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 63.2 bits (152), Expect = 6e-08 Identities = 37/85 (43%), Positives = 49/85 (57%) Frame = +1 Query: 148 WPHTHCKVEASRMLQEQKEAYNDAESLIREDDHVKVQAMTKISTEANHFREFFKGRVSAA 327 W + CK EA R + + N +RE + A S + + FR+FF GRVS+ Sbjct: 30 WICSDCKAEAIRAFPDNSNSNNSNMEKLRERRR-NIPADHNAS-KVDLFRKFFDGRVSSF 87 Query: 328 SDLNKDKGFEDNKRRVPSCPDALHN 402 ++ +KGFEDNKRRVPSCPD LHN Sbjct: 88 NN-RTEKGFEDNKRRVPSCPDPLHN 111