BLASTX nr result
ID: Angelica22_contig00023930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00023930 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329911.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002265516.2| PREDICTED: uncharacterized protein LOC100257... 72 6e-11 ref|XP_003611279.1| hypothetical protein MTR_5g012220 [Medicago ... 72 6e-11 ref|XP_003538725.1| PREDICTED: uncharacterized protein LOC100804... 70 1e-10 ref|XP_003517429.1| PREDICTED: uncharacterized protein LOC100820... 69 5e-10 >ref|XP_002329911.1| predicted protein [Populus trichocarpa] gi|222871148|gb|EEF08279.1| predicted protein [Populus trichocarpa] Length = 277 Score = 72.4 bits (176), Expect = 4e-11 Identities = 37/51 (72%), Positives = 42/51 (82%), Gaps = 3/51 (5%) Frame = -2 Query: 245 VIAGRVRKRVGFDT---KDRVGCDSVSGDNNELLVFDSHAVLPCFLIIYKL 102 V+AGRV K++GFD+ RVG DSVSGDN ELLVFDS AVLPCFLIIY+L Sbjct: 227 VVAGRVTKQIGFDSLIDDCRVGFDSVSGDNGELLVFDSRAVLPCFLIIYRL 277 >ref|XP_002265516.2| PREDICTED: uncharacterized protein LOC100257409 [Vitis vinifera] Length = 286 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = -2 Query: 245 VIAGRVRKRVGFDT--KDRVGCDSVSGDNNELLVFDSHAVLPCFLIIYKL 102 VIAGRV K++G D+ + RVG DSVSGDN ELLVFD AVLPCFLIIYKL Sbjct: 237 VIAGRVSKQIGLDSLLEGRVGFDSVSGDNGELLVFDPRAVLPCFLIIYKL 286 >ref|XP_003611279.1| hypothetical protein MTR_5g012220 [Medicago truncatula] gi|355512614|gb|AES94237.1| hypothetical protein MTR_5g012220 [Medicago truncatula] Length = 290 Score = 71.6 bits (174), Expect = 6e-11 Identities = 39/51 (76%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 245 VIAGRVRKRVGFDTK---DRVGCDSVSGDNNELLVFDSHAVLPCFLIIYKL 102 VIAGRV KRVGF RVG DSVSGDN ELLVFDS AVLPCFLIIY+L Sbjct: 240 VIAGRVSKRVGFVDSLLDGRVGFDSVSGDNGELLVFDSRAVLPCFLIIYRL 290 >ref|XP_003538725.1| PREDICTED: uncharacterized protein LOC100804686 [Glycine max] Length = 285 Score = 70.5 bits (171), Expect = 1e-10 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 245 VIAGRVRKRVGFDTK---DRVGCDSVSGDNNELLVFDSHAVLPCFLIIYKL 102 VIAGR+ K++GF RVG DSVSGDN ELLVFDS AVLPCFLIIYKL Sbjct: 235 VIAGRISKQIGFVESLLDGRVGFDSVSGDNGELLVFDSRAVLPCFLIIYKL 285 >ref|XP_003517429.1| PREDICTED: uncharacterized protein LOC100820460 [Glycine max] Length = 284 Score = 68.6 bits (166), Expect = 5e-10 Identities = 37/51 (72%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -2 Query: 245 VIAGRVRKRVGFDTK---DRVGCDSVSGDNNELLVFDSHAVLPCFLIIYKL 102 VIAGRV K++GF RVG DSVSGD ELLVFDS AVLPCFLIIYKL Sbjct: 234 VIAGRVSKQIGFMESLLDGRVGFDSVSGDKGELLVFDSRAVLPCFLIIYKL 284