BLASTX nr result
ID: Angelica22_contig00023590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00023590 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO34813.1| hypothetical protein [Amblyomma maculatum] 139 2e-31 gb|ACS68665.1| ribosomal protein S18 [Sonneratia alba] gi|241865... 139 2e-31 ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycin... 138 4e-31 ref|XP_002307515.1| predicted protein [Populus trichocarpa] gi|2... 138 4e-31 ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana... 138 5e-31 >gb|AEO34813.1| hypothetical protein [Amblyomma maculatum] Length = 152 Score = 139 bits (351), Expect = 2e-31 Identities = 67/71 (94%), Positives = 71/71 (100%) Frame = -3 Query: 214 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSAEIDSLMTIVANPRQ 35 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS+AE+++LMTIVANPRQ Sbjct: 17 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSAAELENLMTIVANPRQ 76 Query: 34 FKIPDWFLNRK 2 FKIPDWFLNRK Sbjct: 77 FKIPDWFLNRK 87 >gb|ACS68665.1| ribosomal protein S18 [Sonneratia alba] gi|241865406|gb|ACS68735.1| ribosomal protein S18 [Sonneratia alba] Length = 105 Score = 139 bits (350), Expect = 2e-31 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = -3 Query: 214 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSAEIDSLMTIVANPRQ 35 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS+AE+D+LM IVANPRQ Sbjct: 5 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSAAELDNLMVIVANPRQ 64 Query: 34 FKIPDWFLNRK 2 FKIPDWFLNRK Sbjct: 65 FKIPDWFLNRK 75 >ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycine max] gi|255629053|gb|ACU14871.1| unknown [Glycine max] Length = 152 Score = 138 bits (348), Expect = 4e-31 Identities = 65/71 (91%), Positives = 70/71 (98%) Frame = -3 Query: 214 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSAEIDSLMTIVANPRQ 35 NTNVDGKQKIMFA+TSIKGIGRRFANI CKKADVDMNKRAGELS+AE+DS+MT+VANPRQ Sbjct: 17 NTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELSAAELDSVMTVVANPRQ 76 Query: 34 FKIPDWFLNRK 2 FKIPDWFLNRK Sbjct: 77 FKIPDWFLNRK 87 >ref|XP_002307515.1| predicted protein [Populus trichocarpa] gi|222856964|gb|EEE94511.1| predicted protein [Populus trichocarpa] Length = 152 Score = 138 bits (348), Expect = 4e-31 Identities = 66/71 (92%), Positives = 71/71 (100%) Frame = -3 Query: 214 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSAEIDSLMTIVANPRQ 35 NTNVDGKQKIMFALTSIKGIGRRF+NIVCKKADVDMNKRAGELS+AE+D+LMTIVANPRQ Sbjct: 17 NTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADVDMNKRAGELSAAELDNLMTIVANPRQ 76 Query: 34 FKIPDWFLNRK 2 FKIPDWFLNR+ Sbjct: 77 FKIPDWFLNRQ 87 >ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|15234790|ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|18399100|ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|297809155|ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297845304|ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297851838|ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|464707|sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 gi|10086474|gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana] gi|10092450|gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] gi|14423408|gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|15724158|gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana] gi|405613|emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana] gi|434343|emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434345|emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434906|emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana] gi|2505871|emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana] gi|3287678|gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] gi|4538910|emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|7267675|emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|14334584|gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|17979113|gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|21555397|gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21592452|gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21593027|gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|30102858|gb|AAP21347.1| At4g09800 [Arabidopsis thaliana] gi|56236126|gb|AAV84519.1| At1g22780 [Arabidopsis thaliana] gi|98961089|gb|ABF59028.1| At1g22780 [Arabidopsis thaliana] gi|145713244|gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana] gi|145713246|gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana] gi|145713248|gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana] gi|145713250|gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana] gi|145713252|gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana] gi|145713254|gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana] gi|145713256|gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana] gi|145713258|gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana] gi|145713260|gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana] gi|145713262|gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana] gi|145713264|gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana] gi|145713266|gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana] gi|145713268|gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana] gi|145713270|gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana] gi|145713272|gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana] gi|145713274|gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana] gi|145713276|gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana] gi|145713278|gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana] gi|145713280|gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana] gi|145713282|gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana] gi|145713284|gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana] gi|297318298|gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297336375|gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297339642|gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|332192166|gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332193538|gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332657400|gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana] Length = 152 Score = 138 bits (347), Expect = 5e-31 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = -3 Query: 214 NTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSAEIDSLMTIVANPRQ 35 NTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGELS+AEID+LMTIVANPRQ Sbjct: 17 NTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPRQ 76 Query: 34 FKIPDWFLNRK 2 FKIPDWFLNR+ Sbjct: 77 FKIPDWFLNRQ 87