BLASTX nr result
ID: Angelica22_contig00023491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00023491 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69822.1| Hop-interacting protein THI141 [Solanum lycopersi... 105 4e-21 ref|XP_002324004.1| predicted protein [Populus trichocarpa] gi|2... 104 8e-21 ref|XP_002524653.1| hypothetical protein RCOM_1095450 [Ricinus c... 102 2e-20 emb|CAJ13711.1| putative ethylene response protein [Capsicum chi... 99 4e-19 ref|NP_196972.1| universal stress protein (USP) family protein [... 97 2e-18 >gb|AEW69822.1| Hop-interacting protein THI141 [Solanum lycopersicum] Length = 175 Score = 105 bits (262), Expect = 4e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +2 Query: 119 TRVMMGVNESTIKGYPHASISSKGAFEWTLNKIIRSNFSGFKLLFLHVQVPDED 280 TRVM+ VNESTIKGYPHASISSKGAFEWTLNKI+RSN SGFKLLFLHVQVPDED Sbjct: 6 TRVMVAVNESTIKGYPHASISSKGAFEWTLNKIVRSNTSGFKLLFLHVQVPDED 59 >ref|XP_002324004.1| predicted protein [Populus trichocarpa] gi|222867006|gb|EEF04137.1| predicted protein [Populus trichocarpa] Length = 176 Score = 104 bits (259), Expect = 8e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 119 TRVMMGVNESTIKGYPHASISSKGAFEWTLNKIIRSNFSGFKLLFLHVQVPDED 280 TR+MMGVNESTIKGYPHASISS+GAF+WTL KI+RSN SGFKLLFLHVQVPDED Sbjct: 7 TRIMMGVNESTIKGYPHASISSRGAFDWTLQKIVRSNTSGFKLLFLHVQVPDED 60 >ref|XP_002524653.1| hypothetical protein RCOM_1095450 [Ricinus communis] gi|223536014|gb|EEF37672.1| hypothetical protein RCOM_1095450 [Ricinus communis] Length = 152 Score = 102 bits (255), Expect = 2e-20 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = +2 Query: 116 PTRVMMGVNESTIKGYPHASISSKGAFEWTLNKIIRSNFSGFKLLFLHVQVPDED 280 PTR+M+GVNESTIKGYPH SISSKGAF+WTL+KI+RSN S FKLLFLHVQVPDED Sbjct: 6 PTRIMIGVNESTIKGYPHPSISSKGAFDWTLSKIVRSNTSAFKLLFLHVQVPDED 60 >emb|CAJ13711.1| putative ethylene response protein [Capsicum chinense] Length = 175 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +2 Query: 119 TRVMMGVNESTIKGYPHASISSKGAFEWTLNKIIRSNFSGFKLLFLHVQVPDED 280 T VM+ V+ESTI GYPHASISSKGAFEWTLNKI+RSN SGFKLLFLHVQVPDED Sbjct: 6 TLVMVAVSESTINGYPHASISSKGAFEWTLNKIVRSNTSGFKLLFLHVQVPDED 59 >ref|NP_196972.1| universal stress protein (USP) family protein [Arabidopsis thaliana] gi|7573317|emb|CAB87635.1| putative protein [Arabidopsis thaliana] gi|45476563|gb|AAS65947.1| At5g14680 [Arabidopsis thaliana] gi|52627107|gb|AAU84680.1| At5g14680 [Arabidopsis thaliana] gi|332004679|gb|AED92062.1| universal stress protein (USP) family protein [Arabidopsis thaliana] Length = 175 Score = 96.7 bits (239), Expect = 2e-18 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 116 PTRVMMGVNESTIKGYPHASISSKGAFEWTLNKIIRSNFSGFKLLFLHVQVPDED 280 PTRVM+ VNEST+KGYPHASISSK AFEWTL KI+RSN SGFKLL LHVQV DED Sbjct: 5 PTRVMVAVNESTLKGYPHASISSKKAFEWTLKKIVRSNTSGFKLLLLHVQVQDED 59