BLASTX nr result
ID: Angelica22_contig00022902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022902 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 62 6e-08 ref|XP_003638621.1| F-box/LRR-repeat protein [Medicago truncatul... 59 4e-07 ref|XP_003621924.1| F-box/LRR-repeat protein [Medicago truncatul... 58 7e-07 ref|XP_003638633.1| F-box/LRR-repeat protein [Medicago truncatul... 55 8e-06 >ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355521185|gb|AET01639.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 600 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +1 Query: 40 DDDRISNLPLVLKHSILDGVPLHDAARTSTLSKAWRTTWTTQPSLAF 180 D+DR+SNLP V+ HSIL +P DAARTS LSK+W TW T P L+F Sbjct: 4 DEDRLSNLPKVILHSILSRLPEKDAARTSVLSKSWLETWHTFPILSF 50 >ref|XP_003638621.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355504556|gb|AES85759.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 491 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +1 Query: 40 DDDRISNLPLVLKHSILDGVPLHDAARTSTLSKAWRTTWTTQPSLAF 180 D+DR+SNLP V+ HSI+ +P DAA+TS LSK W TW T P L+F Sbjct: 4 DEDRLSNLPKVILHSIMSRLPEEDAAKTSVLSKDWLETWYTFPILSF 50 >ref|XP_003621924.1| F-box/LRR-repeat protein [Medicago truncatula] gi|124361155|gb|ABN09127.1| Cyclin-like F-box [Medicago truncatula] gi|355496939|gb|AES78142.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 363 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +1 Query: 40 DDDRISNLPLVLKHSILDGVPLHDAARTSTLSKAWRTTWTTQPSLAF 180 ++DR+SNLP ++ H IL +P DAARTS LSKAW TW T P L F Sbjct: 18 EEDRLSNLPKIILHHILSRLPEKDAARTSVLSKAWTYTWLTFPILYF 64 >ref|XP_003638633.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355504568|gb|AES85771.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 545 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +1 Query: 40 DDDRISNLPLVLKHSILDGVPLHDAARTSTLSKAWRTTWTTQPSLAF 180 ++D++S LP ++ H+IL +P DAARTS LSK+W TW T P L+F Sbjct: 5 EEDQLSTLPKIILHNILSRLPEKDAARTSVLSKSWLDTWYTFPILSF 51