BLASTX nr result
ID: Angelica22_contig00022859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022859 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612107.1| GATA transcription factor [Medicago truncatu... 80 2e-13 gb|ABB45844.1| hypothetical protein [Eutrema halophilum] 80 2e-13 gb|AFK34183.1| unknown [Medicago truncatula] 80 2e-13 gb|ADL36694.1| GATA domain class transcription factor [Malus x d... 80 2e-13 ref|XP_002876069.1| hypothetical protein ARALYDRAFT_323669 [Arab... 80 2e-13 >ref|XP_003612107.1| GATA transcription factor [Medicago truncatula] gi|355513442|gb|AES95065.1| GATA transcription factor [Medicago truncatula] Length = 390 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 FKSGRLLPEYRPACSPTFSSEIHSNNHRKVMEMRRKKEGEDGFVVPV 143 FKSGRLLPEYRPACSPTFSSE+HSN+HRKV+EMRRKKE G + V Sbjct: 331 FKSGRLLPEYRPACSPTFSSELHSNHHRKVLEMRRKKEVVGGVEIEV 377 >gb|ABB45844.1| hypothetical protein [Eutrema halophilum] Length = 332 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 FKSGRLLPEYRPACSPTFSSEIHSNNHRKVMEMRRKKEGED 125 +KSGRLLPEYRPACSPTFSSE+HSN+HRKVMEMRRKKE D Sbjct: 273 YKSGRLLPEYRPACSPTFSSELHSNHHRKVMEMRRKKEPTD 313 >gb|AFK34183.1| unknown [Medicago truncatula] Length = 86 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 3 FKSGRLLPEYRPACSPTFSSEIHSNNHRKVMEMRRKKEGEDGF 131 +KSGRLLPEYRPACSPTFSSE+HSN+HRKV+EMRRKKE GF Sbjct: 44 YKSGRLLPEYRPACSPTFSSELHSNHHRKVIEMRRKKEVVPGF 86 >gb|ADL36694.1| GATA domain class transcription factor [Malus x domestica] Length = 331 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 FKSGRLLPEYRPACSPTFSSEIHSNNHRKVMEMRRKKEG 119 +KSGRLLPEYRPACSPTFSSE+HSN+HRKV+EMRRKKEG Sbjct: 276 YKSGRLLPEYRPACSPTFSSELHSNHHRKVIEMRRKKEG 314 >ref|XP_002876069.1| hypothetical protein ARALYDRAFT_323669 [Arabidopsis lyrata subsp. lyrata] gi|297321907|gb|EFH52328.1| hypothetical protein ARALYDRAFT_323669 [Arabidopsis lyrata subsp. lyrata] Length = 314 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 FKSGRLLPEYRPACSPTFSSEIHSNNHRKVMEMRRKKEGED 125 +KSGRLLPEYRPACSPTFSSE+HSN+HRKV+EMRRKKE D Sbjct: 257 YKSGRLLPEYRPACSPTFSSELHSNHHRKVIEMRRKKEASD 297