BLASTX nr result
ID: Angelica22_contig00022846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022846 (666 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514685.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002514685.1| conserved hypothetical protein [Ricinus communis] gi|223546289|gb|EEF47791.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 64.3 bits (155), Expect = 2e-08 Identities = 42/119 (35%), Positives = 64/119 (53%), Gaps = 10/119 (8%) Frame = -1 Query: 570 ARTQSPIWKLTPGNNSSKMSNLYDSYELQAVSKQINRAIRGSKSPLSPYSYYMNLTPYCS 391 A P ++LTP +N S LYDSYE +AV++Q+N+A++ S + Y+ +P+ S Sbjct: 28 AHALKPTYRLTPRHNGS---TLYDSYEFRAVTEQLNKAMQSLNSSSPTFMSYLK-SPFYS 83 Query: 390 RRSSCL------PTKRICYPRLESKTHNPQLNCKGNR----GIMSRLWKRIKAGLASSK 244 R + KRI R+ + + + + KG+R G SRLWK+IK GL SK Sbjct: 84 HRLDSIYKENSETQKRIMCSRINQRYSDKKASRKGSRVMSGGFASRLWKKIKEGLLWSK 142