BLASTX nr result
ID: Angelica22_contig00022766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022766 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615134.1| Serine protease htrA-like protein [Medicago ... 57 1e-06 >ref|XP_003615134.1| Serine protease htrA-like protein [Medicago truncatula] gi|355516469|gb|AES98092.1| Serine protease htrA-like protein [Medicago truncatula] Length = 419 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/70 (38%), Positives = 42/70 (60%) Frame = -1 Query: 229 SVADDIKVDVYLFDRSVCEGEILGYDFHHNVAAIRI*SDVQLQTAVIRNLDDNMECHARF 50 S+AD++KV ++L+D EG++ YDFH N+A I+ SD L TA++R +DD + + Sbjct: 135 SLADNLKVKIFLYDGRSYEGQVRAYDFHFNIAWIQFQSDRSLPTAILRQVDDYINVNPAV 194 Query: 49 GDTSLHLGRH 20 H RH Sbjct: 195 AKLFRHHRRH 204