BLASTX nr result
ID: Angelica22_contig00022727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022727 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thal... 51 8e-07 ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana... 51 1e-06 gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzym... 51 1e-06 >gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana] Length = 675 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 249 ELMDRHNWEDRDMIYKLMIGSELFGRKDRGGVVFASPD 136 +L+D HN DRD IY LM+ S LF RK+RGG +F SPD Sbjct: 55 KLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD 92 Score = 26.9 bits (58), Expect(2) = 8e-07 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 349 QSQHPQS--FLEPSTCLHSSSPDLSEPILFDTHEMR 248 QS P S L CL S P+L+E FD EMR Sbjct: 19 QSNPPSSNPSLSREVCLQYSPPELNESYGFDVKEMR 54 >ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] gi|342161829|sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA oxidase; Short=AtCX3; Flags: Precursor gi|8515709|gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana] gi|20466227|gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana] gi|30725500|gb|AAP37772.1| At1g06290 [Arabidopsis thaliana] gi|51970656|dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana] gi|332189851|gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] Length = 675 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 249 ELMDRHNWEDRDMIYKLMIGSELFGRKDRGGVVFASPD 136 +L+D HN DRD IY LM+ S LF RK+RGG +F SPD Sbjct: 55 KLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD 92 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 349 QSQHPQS--FLEPSTCLHSSSPDLSEPILFDTHEMR 248 QS P S L CL S P+L+E FD EMR Sbjct: 19 QSNPPSSNPSLSRELCLQYSPPELNESYGFDVKEMR 54 >gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzyme A oxidase I precursor from Candida tropicalis gb|M12161 [Arabidopsis thaliana] Length = 305 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 249 ELMDRHNWEDRDMIYKLMIGSELFGRKDRGGVVFASPD 136 +L+D HN DRD IY LM+ S LF RK+RGG +F SPD Sbjct: 55 KLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPD 92 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 349 QSQHPQS--FLEPSTCLHSSSPDLSEPILFDTHEMR 248 QS P S L CL S P+L+E FD EMR Sbjct: 19 QSNPPSSNPSLSRELCLQYSPPELNESYGFDVKEMR 54