BLASTX nr result
ID: Angelica22_contig00022725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022725 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein k... 91 1e-16 gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] 71 1e-10 ref|XP_002316527.1| calcium dependent protein kinase 21 [Populus... 60 1e-07 gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum c... 59 3e-07 gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum] 58 7e-07 >sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase; Short=CDPK gi|1765912|emb|CAA39936.1| calcium- dependent protein kinase [Daucus carota] Length = 532 Score = 90.5 bits (223), Expect = 1e-16 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = +1 Query: 91 TGPSLKPRQVHRPEPNTILGKPFEDIRAKYTLGKELGRGQFGC 219 TGPSLKPRQVHRPE NTILGKPFEDIR KYTLGKELGRGQFGC Sbjct: 52 TGPSLKPRQVHRPESNTILGKPFEDIRGKYTLGKELGRGQFGC 94 >gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] Length = 549 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 109 PRQVHRPEPNTILGKPFEDIRAKYTLGKELGRGQFG 216 PR VH+PEPNTILGK FEDIRA YTLGKELGRGQFG Sbjct: 77 PRPVHKPEPNTILGKKFEDIRAHYTLGKELGRGQFG 112 >ref|XP_002316527.1| calcium dependent protein kinase 21 [Populus trichocarpa] gi|222859592|gb|EEE97139.1| calcium dependent protein kinase 21 [Populus trichocarpa] Length = 532 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%) Frame = +1 Query: 97 PSLKPRQVH-----RPEPNTILGKPFEDIRAKYTLGKELGRGQFG 216 P +P+Q RP P+TILGKPFEDI+ YTLGKELGRGQFG Sbjct: 54 PPTRPQQTQQQTPTRPAPDTILGKPFEDIKQHYTLGKELGRGQFG 98 >gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum] Length = 534 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 109 PRQVHRPEPNTILGKPFEDIRAKYTLGKELGRGQFG 216 P+ + EPNTILGKPFED++ YTLG+ELGRGQFG Sbjct: 63 PKPAPKVEPNTILGKPFEDVKVYYTLGRELGRGQFG 98 >gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 522 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 97 PSLKPRQVHRPEPNTILGKPFEDIRAKYTLGKELGRGQFG 216 PS P+ V + E TILGKPFED++A YTLGKELGRGQFG Sbjct: 49 PSASPKPVFKQE--TILGKPFEDVKAYYTLGKELGRGQFG 86