BLASTX nr result
ID: Angelica22_contig00022284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00022284 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521918.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002883284.1| hypothetical protein ARALYDRAFT_318850 [Arab... 55 6e-06 >ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = -1 Query: 160 NLQWEKMTSAPVARLDGFAIQINNL---FAGYGTIDVV 56 +L+WEKMTSAPV RLDG AIQI NL FAGYGTID V Sbjct: 95 DLKWEKMTSAPVPRLDGAAIQIKNLLYVFAGYGTIDYV 132 >ref|XP_002883284.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] gi|297329124|gb|EFH59543.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] Length = 409 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 157 LQWEKMTSAPVARLDGFAIQINN---LFAGYGTIDVV 56 L+WEKMT+APV RLDG AIQI N +FAGYGTID+V Sbjct: 80 LKWEKMTAAPVPRLDGAAIQIRNFLYVFAGYGTIDIV 116