BLASTX nr result
ID: Angelica22_contig00021973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021973 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514896.1| conserved hypothetical protein [Ricinus comm... 89 4e-16 ref|XP_002511164.1| conserved hypothetical protein [Ricinus comm... 86 3e-15 ref|XP_003553183.1| PREDICTED: uncharacterized protein LOC100527... 85 7e-15 ref|XP_003601753.1| hypothetical protein MTR_3g085020 [Medicago ... 85 7e-15 emb|CBI15682.3| unnamed protein product [Vitis vinifera] 85 7e-15 >ref|XP_002514896.1| conserved hypothetical protein [Ricinus communis] gi|223545947|gb|EEF47450.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 58 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMHTSGLSILV 195 MADWGPV+IAVVLFVLLSPGLLFQLPG+GRVVEFGNM TSGLSILV Sbjct: 1 MADWGPVVIAVVLFVLLSPGLLFQLPGKGRVVEFGNMQTSGLSILV 46 >ref|XP_002511164.1| conserved hypothetical protein [Ricinus communis] gi|223550279|gb|EEF51766.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 58 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMHTSGLSILV 195 MADWGPV+IAV+LFVLL+PGLLFQ+PGR RVVEFGNMHTSG SI+V Sbjct: 1 MADWGPVIIAVILFVLLTPGLLFQIPGRNRVVEFGNMHTSGASIVV 46 >ref|XP_003553183.1| PREDICTED: uncharacterized protein LOC100527578 [Glycine max] Length = 69 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +1 Query: 58 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMHTSGLSILV 195 MADWGPV+IAVVLFVLLSPGLLFQLPGR RVVEFGNM TS +SILV Sbjct: 1 MADWGPVVIAVVLFVLLSPGLLFQLPGRSRVVEFGNMQTSAISILV 46 >ref|XP_003601753.1| hypothetical protein MTR_3g085020 [Medicago truncatula] gi|355490801|gb|AES72004.1| hypothetical protein MTR_3g085020 [Medicago truncatula] Length = 69 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 58 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMHTSGLSILV 195 MADWGPV+IAVVLFVLLSPGLLFQ+PGR +VVEFGNM TSG+SILV Sbjct: 1 MADWGPVVIAVVLFVLLSPGLLFQMPGRNKVVEFGNMQTSGVSILV 46 >emb|CBI15682.3| unnamed protein product [Vitis vinifera] Length = 138 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 58 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMHTSGLSILV 195 MADWGPVLIAVVLFVLL+PGLLFQ+PG+ RVVEFG+MHTSG SILV Sbjct: 22 MADWGPVLIAVVLFVLLTPGLLFQVPGKNRVVEFGSMHTSGASILV 67