BLASTX nr result
ID: Angelica22_contig00021913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021913 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15961.3| unnamed protein product [Vitis vinifera] 58 7e-07 emb|CAN61894.1| hypothetical protein VITISV_028791 [Vitis vinifera] 58 7e-07 dbj|BAJ34285.1| unnamed protein product [Thellungiella halophila] 56 3e-06 ref|XP_002525634.1| ubiquitin-protein ligase, putative [Ricinus ... 56 3e-06 ref|XP_002323576.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 >emb|CBI15961.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 214 DLWIYTSPSDIVDLTAIARESIKRLIIYIKKLP-IVAEPTIVRYNSH 77 DLWIYT +DIVDLT I RE++KRL +YI +LP ++ +P V Y SH Sbjct: 195 DLWIYTDNTDIVDLTYIMRENLKRLFMYIDRLPLVIPDPVYVPYESH 241 >emb|CAN61894.1| hypothetical protein VITISV_028791 [Vitis vinifera] Length = 592 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 214 DLWIYTSPSDIVDLTAIARESIKRLIIYIKKLP-IVAEPTIVRYNSH 77 DLWIYT +DIVDLT I RE++KRL +YI +LP ++ +P V Y SH Sbjct: 544 DLWIYTDNTDIVDLTYIXRENLKRLFMYIDRLPLVIPDPVYVPYESH 590 >dbj|BAJ34285.1| unnamed protein product [Thellungiella halophila] Length = 242 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -2 Query: 214 DLWIYTSPSDIVDLTAIARESIKRLIIYIKKLPIVA-EPTIVRY 86 DLW+YTS +IV+L AI +E++KRL++YI KLP+VA +PT+V Y Sbjct: 194 DLWLYTSIKEIVELPAIYKENLKRLLMYIDKLPLVATDPTLVPY 237 >ref|XP_002525634.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535070|gb|EEF36752.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 243 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 214 DLWIYTSPSDIVDLTAIARESIKRLIIYIKKLP-IVAEPTIVRYNSH 77 DLWIYT SD VDL I RE+ KRL +YI+KLP IV + I+ Y+SH Sbjct: 195 DLWIYTDKSDTVDLPLILRENCKRLFMYIEKLPLIVPDHVIIPYDSH 241 >ref|XP_002323576.1| predicted protein [Populus trichocarpa] gi|222868206|gb|EEF05337.1| predicted protein [Populus trichocarpa] Length = 241 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -2 Query: 214 DLWIYTSPSDIVDLTAIARESIKRLIIYIKKLP-IVAEPTIVRYNSHF 74 DLWIYT+ ++I+DL++I R+++KRL +YI KLP IV EP V Y+ + Sbjct: 193 DLWIYTNNNEIIDLSSITRQNLKRLFMYIDKLPLIVPEPIFVSYDPRY 240