BLASTX nr result
ID: Angelica22_contig00021820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021820 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525601.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 >ref|XP_002525601.1| conserved hypothetical protein [Ricinus communis] gi|223535037|gb|EEF36719.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 286 PVEAQKQQTRKCTLPTQALSCSGAKGLSQPDLLCPGT 396 PV+ QK+ RKCTLPTQALSCSG+KGLSQPDLL P T Sbjct: 23 PVQEQKKWKRKCTLPTQALSCSGSKGLSQPDLLNPLT 59