BLASTX nr result
ID: Angelica22_contig00021758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021758 (743 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530291.1| ubiquitin-protein ligase, putative [Ricinus ... 59 1e-06 ref|XP_003540741.1| PREDICTED: F-box/kelch-repeat protein At5g60... 56 9e-06 >ref|XP_002530291.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223530189|gb|EEF32098.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 376 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 646 KFGSNDSLIPGLYDDVALNCLAWACRSDYFAL 741 + GS+DSL+PGL DDVALNCLAWACRSDY +L Sbjct: 25 RLGSSDSLLPGLIDDVALNCLAWACRSDYASL 56 >ref|XP_003540741.1| PREDICTED: F-box/kelch-repeat protein At5g60570-like [Glycine max] Length = 397 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 652 GSNDSLIPGLYDDVALNCLAWACRSDYFAL 741 G NDSL+PGL+DDVALNCLAWA RSDY +L Sbjct: 39 GPNDSLLPGLFDDVALNCLAWASRSDYASL 68