BLASTX nr result
ID: Angelica22_contig00021542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021542 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159818.1| PREDICTED: lipase-like [Cucumis sativus] 63 2e-08 ref|XP_004134193.1| PREDICTED: lipase-like [Cucumis sativus] 63 2e-08 tpg|DAA55926.1| TPA: hypothetical protein ZEAMMB73_207933 [Zea m... 63 3e-08 tpg|DAA55925.1| TPA: hypothetical protein ZEAMMB73_207933 [Zea m... 63 3e-08 ref|NP_001130989.1| lipase precursor [Zea mays] gi|194690642|gb|... 63 3e-08 >ref|XP_004159818.1| PREDICTED: lipase-like [Cucumis sativus] Length = 354 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 156 LKRFFSFIQI*IHCFYKM*VWLHNLGFGTLVYQVETVCDSSGEDPTCSRSVS 1 L F+S+ + + VWL+N+GFG+ VYQVE VCD SGEDP+CSRSVS Sbjct: 232 LPPFYSYFPKKTYHHFPREVWLYNVGFGSFVYQVEKVCDDSGEDPSCSRSVS 283 >ref|XP_004134193.1| PREDICTED: lipase-like [Cucumis sativus] Length = 359 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 156 LKRFFSFIQI*IHCFYKM*VWLHNLGFGTLVYQVETVCDSSGEDPTCSRSVS 1 L F+S+ + + VWL+N+GFG+ VYQVE VCD SGEDP+CSRSVS Sbjct: 237 LPPFYSYFPKKTYHHFPREVWLYNVGFGSFVYQVEKVCDDSGEDPSCSRSVS 288 >tpg|DAA55926.1| TPA: hypothetical protein ZEAMMB73_207933 [Zea mays] Length = 346 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = -2 Query: 156 LKRFFSFIQI*IHCFYKM*VWLHNLGFGTLVYQVETVCDSSGEDPTCSRSVS 1 L +FSF + + VW HN+G GTLVY VE +CD SGEDPTC RSVS Sbjct: 236 LPPYFSFFPQKTYHHFPREVWTHNIGLGTLVYPVEKICDDSGEDPTCCRSVS 287 >tpg|DAA55925.1| TPA: hypothetical protein ZEAMMB73_207933 [Zea mays] Length = 376 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = -2 Query: 156 LKRFFSFIQI*IHCFYKM*VWLHNLGFGTLVYQVETVCDSSGEDPTCSRSVS 1 L +FSF + + VW HN+G GTLVY VE +CD SGEDPTC RSVS Sbjct: 266 LPPYFSFFPQKTYHHFPREVWTHNIGLGTLVYPVEKICDDSGEDPTCCRSVS 317 >ref|NP_001130989.1| lipase precursor [Zea mays] gi|194690642|gb|ACF79405.1| unknown [Zea mays] gi|195629554|gb|ACG36418.1| lipase precursor [Zea mays] gi|223947827|gb|ACN27997.1| unknown [Zea mays] gi|414878796|tpg|DAA55927.1| TPA: lipase [Zea mays] Length = 345 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = -2 Query: 156 LKRFFSFIQI*IHCFYKM*VWLHNLGFGTLVYQVETVCDSSGEDPTCSRSVS 1 L +FSF + + VW HN+G GTLVY VE +CD SGEDPTC RSVS Sbjct: 235 LPPYFSFFPQKTYHHFPREVWTHNIGLGTLVYPVEKICDDSGEDPTCCRSVS 286