BLASTX nr result
ID: Angelica22_contig00021225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021225 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-16 ref|XP_002522543.1| pentatricopeptide repeat-containing protein,... 85 5e-15 ref|XP_002305756.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_004163477.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 >ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Glycine max] Length = 525 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/67 (64%), Positives = 53/67 (79%) Frame = -2 Query: 241 ARKVFDELPHPTLSAYNYLLSGYVKSGKISESFSLVRRLCFSGECPDGFTFSMILKASTS 62 AR+VFD+L TLSAYNY++SGY+K ++ ES LV RL SGE PDGFTFSMILKASTS Sbjct: 90 ARQVFDDLRDRTLSAYNYMISGYLKQDQVEESLGLVHRLLVSGEKPDGFTFSMILKASTS 149 Query: 61 DCVLAMI 41 C +A++ Sbjct: 150 GCNVALL 156 >ref|XP_002522543.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538234|gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 530 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = -2 Query: 241 ARKVFDELPHPTLSAYNYLLSGYVKSGKISESFSLVRRLCFSGECPDGFTFSMILKASTS 62 AR++FDELP TLSAYNYL+ GY+K G + +S +LVRRL G+ PDGFT+SMILKASTS Sbjct: 96 ARQMFDELPQRTLSAYNYLIGGYLKLGLVQDSMNLVRRLVLEGQRPDGFTYSMILKASTS 155 >ref|XP_002305756.1| predicted protein [Populus trichocarpa] gi|222848720|gb|EEE86267.1| predicted protein [Populus trichocarpa] Length = 530 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/60 (66%), Positives = 47/60 (78%) Frame = -2 Query: 241 ARKVFDELPHPTLSAYNYLLSGYVKSGKISESFSLVRRLCFSGECPDGFTFSMILKASTS 62 A ++FDELP TLSAYNY++ GY++ G ES S+VRRL GE PDGFTFSMILKASTS Sbjct: 96 AHQLFDELPQRTLSAYNYMIGGYLRQGLFEESISMVRRLDLDGERPDGFTFSMILKASTS 155 >ref|XP_004163477.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Cucumis sativus] Length = 523 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = -2 Query: 241 ARKVFDELPHPTLSAYNYLLSGYVKSGKISESFSLVRRLCFSGECPDGFTFSMILKAST 65 AR+ FD LP TLSAYNY++ GY+K G++ ES LVR L SGE PDGFTFSM+LKAST Sbjct: 88 ARQAFDALPQKTLSAYNYMIGGYMKMGEVPESLPLVRELICSGEKPDGFTFSMLLKAST 146 >ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Cucumis sativus] Length = 523 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = -2 Query: 241 ARKVFDELPHPTLSAYNYLLSGYVKSGKISESFSLVRRLCFSGECPDGFTFSMILKAST 65 AR+ FD LP TLSAYNY++ GY+K G++ ES LVR L SGE PDGFTFSM+LKAST Sbjct: 88 ARQAFDALPQKTLSAYNYMIGGYMKMGEVPESLPLVRELICSGEKPDGFTFSMLLKAST 146