BLASTX nr result
ID: Angelica22_contig00021078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00021078 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO35358.1| Acyl-CoA dehydrogenase [Elaeis oleifera] 59 3e-07 gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] 59 4e-07 ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis... 59 4e-07 ref|XP_004172571.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 59 5e-07 ref|XP_004152392.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 59 5e-07 >gb|ACO35358.1| Acyl-CoA dehydrogenase [Elaeis oleifera] Length = 237 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 84 DELVVLYNIYALSLLHKHRGEFLATSSITAKQASLVIAQLRNLYSQV 224 ++L +L NIYALS+LHKH +FL T IT KQASL QLR+LYSQ+ Sbjct: 123 EQLQILCNIYALSVLHKHVSDFLVTGCITPKQASLANDQLRSLYSQI 169 >gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] Length = 664 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +3 Query: 84 DELVVLYNIYALSLLHKHRGEFLATSSITAKQASLVIAQLRNLYSQV 224 ++L L NIYAL ++HKH G+FL+T SITAKQASL QLR+LYS++ Sbjct: 550 EQLQNLCNIYALYIIHKHLGDFLSTGSITAKQASLANDQLRSLYSKL 596 >ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis] gi|223535400|gb|EEF37074.1| acyl-CoA oxidase, putative [Ricinus communis] Length = 664 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +3 Query: 87 ELVVLYNIYALSLLHKHRGEFLATSSITAKQASLVIAQLRNLYSQV 224 +L +L +YAL+LLHKH+G+FL+T IT KQASL QLR+LYSQV Sbjct: 551 QLQILCYMYALNLLHKHQGDFLSTGCITPKQASLANDQLRSLYSQV 596 >ref|XP_004172571.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like, partial [Cucumis sativus] Length = 341 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 84 DELVVLYNIYALSLLHKHRGEFLATSSITAKQASLVIAQLRNLYSQV 224 D+L L +IYAL LHKH G+FL+TS+IT KQASL QLR+LY+QV Sbjct: 227 DQLQKLCSIYALFTLHKHLGDFLSTSTITPKQASLADDQLRSLYAQV 273 >ref|XP_004152392.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Cucumis sativus] Length = 663 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 84 DELVVLYNIYALSLLHKHRGEFLATSSITAKQASLVIAQLRNLYSQV 224 D+L L +IYAL LHKH G+FL+TS+IT KQASL QLR+LY+QV Sbjct: 549 DQLQKLCSIYALFTLHKHLGDFLSTSTITPKQASLADDQLRSLYAQV 595