BLASTX nr result
ID: Angelica22_contig00020831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020831 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46115.1| unknown [Medicago truncatula] 77 1e-12 ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medi... 76 3e-12 gb|AFK34133.1| unknown [Lotus japonicus] 75 5e-12 gb|AAF79605.1|AC027665_6 F5M15.10 [Arabidopsis thaliana] 75 7e-12 ref|XP_002893120.1| hypothetical protein ARALYDRAFT_889509 [Arab... 75 7e-12 >gb|AFK46115.1| unknown [Medicago truncatula] Length = 243 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 390 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 280 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL Sbjct: 204 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 240 >ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] gi|355486406|gb|AES67609.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] Length = 271 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 390 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 280 GYHI+EVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL Sbjct: 232 GYHIKEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 268 >gb|AFK34133.1| unknown [Lotus japonicus] Length = 243 Score = 75.1 bits (183), Expect = 5e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 390 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 280 GYHIEEVPITFVDRVYGSSKLGGSEIV+YLKG+VYLL Sbjct: 204 GYHIEEVPITFVDRVYGSSKLGGSEIVQYLKGVVYLL 240 >gb|AAF79605.1|AC027665_6 F5M15.10 [Arabidopsis thaliana] Length = 256 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 390 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 280 GYHIEEVPITFVDRV+G+SKLGGSEIVEYLKGLVYLL Sbjct: 217 GYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLVYLL 253 >ref|XP_002893120.1| hypothetical protein ARALYDRAFT_889509 [Arabidopsis lyrata subsp. lyrata] gi|297338962|gb|EFH69379.1| hypothetical protein ARALYDRAFT_889509 [Arabidopsis lyrata subsp. lyrata] Length = 246 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 390 GYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLL 280 GYHIEEVPITFVDRV+G+SKLGGSEIVEYLKGLVYLL Sbjct: 207 GYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLVYLL 243