BLASTX nr result
ID: Angelica22_contig00020629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020629 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK27122.1| unknown [Picea sitchensis] 84 9e-15 ref|XP_002279805.1| PREDICTED: mitochondrial inner membrane prot... 83 2e-14 gb|AFW57676.1| hypothetical protein ZEAMMB73_249952 [Zea mays] g... 83 3e-14 ref|XP_002446089.1| hypothetical protein SORBIDRAFT_06g001580 [S... 82 5e-14 ref|XP_002528106.1| mitochondrial inner membrane protease subuni... 80 2e-13 >gb|ABK27122.1| unknown [Picea sitchensis] Length = 170 Score = 84.3 bits (207), Expect = 9e-15 Identities = 33/53 (62%), Positives = 45/53 (84%) Frame = -2 Query: 399 CWVEGDNSASSLDSKSIGPVPLGLIKGRATHIIWPPNRIGKVDREFLKADLSS 241 CWVEGDN+ SSLDS+S GPVPLGL++GR TH+IWPP R+G +++++ K +SS Sbjct: 117 CWVEGDNAVSSLDSRSFGPVPLGLVQGRVTHVIWPPERVGAIEKQYPKERVSS 169 >ref|XP_002279805.1| PREDICTED: mitochondrial inner membrane protease subunit 2 [Vitis vinifera] gi|297740215|emb|CBI30397.3| unnamed protein product [Vitis vinifera] Length = 170 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 399 CWVEGDNSASSLDSKSIGPVPLGLIKGRATHIIWPPNRIGKVDR 268 CWVEGDNSASSLDS+S GPVPLGL GRATHI+WPP RIG+V+R Sbjct: 117 CWVEGDNSASSLDSRSFGPVPLGLACGRATHIVWPPQRIGEVER 160 >gb|AFW57676.1| hypothetical protein ZEAMMB73_249952 [Zea mays] gi|413917745|gb|AFW57677.1| hypothetical protein ZEAMMB73_249952 [Zea mays] Length = 163 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = -2 Query: 399 CWVEGDNSASSLDSKSIGPVPLGLIKGRATHIIWPPNRIGKVDRE 265 CWVEGDN+A+S DS+S GPVP+GL++GR THIIWPP+RIG+VDR+ Sbjct: 110 CWVEGDNAATSFDSRSYGPVPMGLLRGRVTHIIWPPHRIGRVDRK 154 >ref|XP_002446089.1| hypothetical protein SORBIDRAFT_06g001580 [Sorghum bicolor] gi|241937272|gb|EES10417.1| hypothetical protein SORBIDRAFT_06g001580 [Sorghum bicolor] Length = 163 Score = 82.0 bits (201), Expect = 5e-14 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 399 CWVEGDNSASSLDSKSIGPVPLGLIKGRATHIIWPPNRIGKVDRE 265 CW+EGDN+A SLDS+S GPVP+GL++GR THIIWPP RIG+VDR+ Sbjct: 110 CWIEGDNAALSLDSRSYGPVPMGLLQGRVTHIIWPPQRIGRVDRK 154 >ref|XP_002528106.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] gi|223532495|gb|EEF34285.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] Length = 170 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -2 Query: 399 CWVEGDNSASSLDSKSIGPVPLGLIKGRATHIIWPPNRIGKVDREFLKADLSS 241 CWVEGDN SS+DS+ GPVPLGLI GR THI+WPP RIG+V+++ + LSS Sbjct: 117 CWVEGDNLLSSMDSRYFGPVPLGLISGRVTHIVWPPQRIGEVEKKIPQGRLSS 169