BLASTX nr result
ID: Angelica22_contig00020620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020620 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis tha... 67 2e-09 ref|NP_190516.1| nascent polypeptide-associated complex subunit ... 67 2e-09 ref|XP_002875967.1| nascent polypeptide-associated complex domai... 67 2e-09 ref|XP_002521293.1| nascent polypeptide associated complex alpha... 67 2e-09 ref|XP_002321358.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 >gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis thaliana] gi|18377570|gb|AAL66951.1| alpha NAC-like protein [Arabidopsis thaliana] Length = 217 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 100 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 2 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV Sbjct: 79 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 111 >ref|NP_190516.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] gi|71151985|sp|Q94JX9.2|NACA2_ARATH RecName: Full=Nascent polypeptide-associated complex subunit alpha-like protein 2; Short=NAC-alpha-like protein 2; AltName: Full=Alpha-NAC-like protein 2 gi|12324452|gb|AAG52192.1|AC012329_19 putative alpha NAC; 61864-63065 [Arabidopsis thaliana] gi|6561948|emb|CAB62452.1| alpha NAC-like protein [Arabidopsis thaliana] gi|332645026|gb|AEE78547.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] Length = 217 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 100 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 2 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV Sbjct: 79 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 111 >ref|XP_002875967.1| nascent polypeptide-associated complex domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297321805|gb|EFH52226.1| nascent polypeptide-associated complex domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 217 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 100 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 2 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV Sbjct: 79 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 111 >ref|XP_002521293.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223539478|gb|EEF41067.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 228 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 2 AMLKLGMKPVTGVSRVTIKRTKN+LFFISKPDV Sbjct: 90 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDV 122 >ref|XP_002321358.1| predicted protein [Populus trichocarpa] gi|222868354|gb|EEF05485.1| predicted protein [Populus trichocarpa] Length = 225 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 100 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDV 2 AMLKLGMKPVTGVSRVTIKRTKN+LFFISKPDV Sbjct: 87 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDV 119