BLASTX nr result
ID: Angelica22_contig00020606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020606 (195 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596877.1| Pentatricopeptide repeat-containing protein ... 90 2e-16 ref|XP_003626823.1| Pentatricopeptide repeat-containing protein ... 90 2e-16 ref|XP_003596871.1| Pentatricopeptide repeat-containing protein ... 90 2e-16 ref|XP_004144516.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-16 ref|XP_002523877.1| pentatricopeptide repeat-containing protein,... 87 1e-15 >ref|XP_003596877.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240912|gb|ABD32770.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355485925|gb|AES67128.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 316 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -2 Query: 191 NTLPGVLKACGGLSGLRIGRIVHGFVVVNGFVLDLANLNGLVTMYAKCGDLVGARKVFDG 12 +TLP VLK+C GLS LR+G+ VHG V+VNGF LDL N N L+ MYAKCG+L ARKVFDG Sbjct: 110 HTLPLVLKSCAGLSALRLGKQVHGAVLVNGFALDLKNSNALINMYAKCGELEFARKVFDG 169 Query: 11 MSE 3 M E Sbjct: 170 MCE 172 >ref|XP_003626823.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355520845|gb|AET01299.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 355 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -2 Query: 191 NTLPGVLKACGGLSGLRIGRIVHGFVVVNGFVLDLANLNGLVTMYAKCGDLVGARKVFDG 12 +TLP VLK+C GLS LR+G+ VHG V+VNGF LDL N N L+ MYAKCG+L ARKVFDG Sbjct: 110 HTLPLVLKSCAGLSALRLGKQVHGAVLVNGFALDLKNSNALINMYAKCGELEFARKVFDG 169 Query: 11 MSE 3 M E Sbjct: 170 MCE 172 >ref|XP_003596871.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124359886|gb|ABD32760.2| Tetratricopeptide-like helical [Medicago truncatula] gi|355485919|gb|AES67122.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 316 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -2 Query: 191 NTLPGVLKACGGLSGLRIGRIVHGFVVVNGFVLDLANLNGLVTMYAKCGDLVGARKVFDG 12 +TLP VLK+C GLS LR+G+ VHG V+VNGF LDL N N L+ MYAKCG+L ARKVFDG Sbjct: 110 HTLPLVLKSCAGLSALRLGKQVHGAVLVNGFALDLKNSNALINMYAKCGELEFARKVFDG 169 Query: 11 MSE 3 M E Sbjct: 170 MCE 172 >ref|XP_004144516.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449515851|ref|XP_004164961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] Length = 308 Score = 89.4 bits (220), Expect = 3e-16 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -2 Query: 194 KNTLPGVLKACGGLSGLRIGRIVHGFVVVNGFVLDLANLNGLVTMYAKCGDLVGARKVFD 15 ++TLP VLK+C GLS LR+GR VHG +++NGF DL +LN L+TMY KCGDL ARKVFD Sbjct: 109 RHTLPPVLKSCTGLSSLRLGRQVHGALLINGFSADLPSLNALITMYGKCGDLGVARKVFD 168 Query: 14 GMSE 3 GM E Sbjct: 169 GMPE 172 >ref|XP_002523877.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536965|gb|EEF38603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 302 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/62 (61%), Positives = 49/62 (79%) Frame = -2 Query: 194 KNTLPGVLKACGGLSGLRIGRIVHGFVVVNGFVLDLANLNGLVTMYAKCGDLVGARKVFD 15 ++TLP VLK+C GLS +R+G+ VHG +++NG DLAN N L+ MYAKCG+L GARKVFD Sbjct: 105 RHTLPSVLKSCAGLSAVRLGQQVHGILLINGLAFDLANSNALINMYAKCGNLAGARKVFD 164 Query: 14 GM 9 M Sbjct: 165 RM 166