BLASTX nr result
ID: Angelica22_contig00020577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020577 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271825.2| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_002317794.1| predicted protein [Populus trichocarpa] gi|2... 82 6e-14 ref|XP_002515645.1| pentatricopeptide repeat-containing protein,... 73 3e-11 ref|XP_003544342.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_003544044.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 >ref|XP_002271825.2| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vitis vinifera] Length = 702 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/69 (59%), Positives = 51/69 (73%) Frame = -1 Query: 217 SLSSNHSYISHLDAPLNSRTYALALESCYCPKFGKQVHAQALKNGFHGHEFVDTKLLQMY 38 S +++H+++S LD ++S TYA LESC GKQVHA LK GFHGHEFV+TKLLQMY Sbjct: 45 STAAHHTHLSLLDKQIDSSTYASLLESCRTLNLGKQVHAHTLKTGFHGHEFVETKLLQMY 104 Query: 37 AKCGSLDDA 11 + G LDDA Sbjct: 105 GRFGCLDDA 113 >ref|XP_002317794.1| predicted protein [Populus trichocarpa] gi|222858467|gb|EEE96014.1| predicted protein [Populus trichocarpa] Length = 852 Score = 81.6 bits (200), Expect = 6e-14 Identities = 41/70 (58%), Positives = 46/70 (65%), Gaps = 1/70 (1%) Frame = -1 Query: 217 SLSSNHSYISHLD-APLNSRTYALALESCYCPKFGKQVHAQALKNGFHGHEFVDTKLLQM 41 S N S S LD PLN+ YA L+SC CPK GKQVHA +K GF F+DTKLLQM Sbjct: 44 SQQKNRSNFSLLDNKPLNTSKYASVLDSCKCPKLGKQVHAHTIKTGFDADGFIDTKLLQM 103 Query: 40 YAKCGSLDDA 11 YA+CG L DA Sbjct: 104 YARCGLLKDA 113 >ref|XP_002515645.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545188|gb|EEF46697.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 758 Score = 72.8 bits (177), Expect = 3e-11 Identities = 40/88 (45%), Positives = 51/88 (57%), Gaps = 9/88 (10%) Frame = -1 Query: 247 NFILRRLPSQS---------LSSNHSYISHLDAPLNSRTYALALESCYCPKFGKQVHAQA 95 N++ + P QS L++N+ S P+NS YA L+SC G QVHA A Sbjct: 31 NYVPFQRPKQSPQPLDSVSHLTNNYHLSSLYTKPINSTGYASVLDSCNSQNLGTQVHAHA 90 Query: 94 LKNGFHGHEFVDTKLLQMYAKCGSLDDA 11 +K GFH H+FV TKLLQMYAK G L+ A Sbjct: 91 IKTGFHCHDFVQTKLLQMYAKFGCLECA 118 >ref|XP_003544342.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Glycine max] Length = 551 Score = 68.6 bits (166), Expect = 5e-10 Identities = 43/104 (41%), Positives = 61/104 (58%) Frame = -1 Query: 322 LLMERVSHAXXXXXXXXXTHESKRLNFILRRLPSQSLSSNHSYISHLDAPLNSRTYALAL 143 LL E ++H S R + L LPS +L+ + + + H P +S TYA L Sbjct: 4 LLSEALTHPPLLSHPPRTRSSSNRASLSL--LPS-NLNPHLTLLYH--EPPSSTTYASIL 58 Query: 142 ESCYCPKFGKQVHAQALKNGFHGHEFVDTKLLQMYAKCGSLDDA 11 +SC P GKQ+HA ++K+GF+ HEFV TKLLQMYA+ S ++A Sbjct: 59 DSCGSPILGKQLHAHSIKSGFNAHEFVTTKLLQMYARNCSFENA 102 >ref|XP_003544044.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Glycine max] Length = 688 Score = 68.6 bits (166), Expect = 5e-10 Identities = 43/104 (41%), Positives = 61/104 (58%) Frame = -1 Query: 322 LLMERVSHAXXXXXXXXXTHESKRLNFILRRLPSQSLSSNHSYISHLDAPLNSRTYALAL 143 LL E ++H S R + L LPS +L+ + + + H P +S TYA L Sbjct: 4 LLSEALTHPPLLSHPPRTRSSSNRASLSL--LPS-NLNPHLTLLYH--EPPSSTTYASIL 58 Query: 142 ESCYCPKFGKQVHAQALKNGFHGHEFVDTKLLQMYAKCGSLDDA 11 +SC P GKQ+HA ++K+GF+ HEFV TKLLQMYA+ S ++A Sbjct: 59 DSCGSPILGKQLHAHSIKSGFNAHEFVTTKLLQMYARNCSFENA 102