BLASTX nr result
ID: Angelica22_contig00020414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020414 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ54945.1| type 2 histone deacetylase a [Nicotiana tabacum] 68 8e-10 gb|ACZ54947.1| type 2 histone deacetylase c [Nicotiana tabacum] 67 2e-09 gb|ACZ54946.1| type 2 histone deacetylase b [Nicotiana tabacum] 64 2e-08 emb|CBI30241.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002277422.1| PREDICTED: histone deacetylase HDT1-like [Vi... 62 4e-08 >gb|ACZ54945.1| type 2 histone deacetylase a [Nicotiana tabacum] Length = 295 Score = 68.2 bits (165), Expect = 8e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 144 VPEKKAKLITPEKIDGKKSSVHVATPYPSKQAGKTLANKPNQPIPKT 4 VP+KKAK +TP+K DGKK S HVATP+PSKQAGK+ ANK NQ PK+ Sbjct: 219 VPDKKAKFVTPQKTDGKKGSGHVATPHPSKQAGKSPANK-NQQTPKS 264 >gb|ACZ54947.1| type 2 histone deacetylase c [Nicotiana tabacum] Length = 282 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 141 PEKKAKLITPEKIDGKKSSVHVATPYPSKQAGKTLANKPNQ 19 P+KKAK TP+K DGKK +VHVATP+PSKQAGKT NK NQ Sbjct: 207 PDKKAKFATPQKTDGKKGAVHVATPHPSKQAGKTSGNKSNQ 247 >gb|ACZ54946.1| type 2 histone deacetylase b [Nicotiana tabacum] Length = 294 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -2 Query: 138 EKKAKLITPEKIDGKKSSVHVATPYPSKQAGKTLANKPNQPIPKT 4 +KKAK +TP+K DGKK S HVATP+PSKQAGK+ ANK NQ PK+ Sbjct: 220 DKKAKFVTPQKTDGKKGSGHVATPHPSKQAGKSPANK-NQQTPKS 263 >emb|CBI30241.3| unnamed protein product [Vitis vinifera] Length = 149 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 7/54 (12%) Frame = -2 Query: 144 VPEKKAKLITPEKIDGKKSSV-----HVATPYPSKQAGKTLAN--KPNQPIPKT 4 VP+KKAK +TP+K DGKKS HVATPYPSKQAGKT AN KP Q + K+ Sbjct: 65 VPDKKAKFVTPQKTDGKKSDDKKSGGHVATPYPSKQAGKTPANTEKPKQQVQKS 118 >ref|XP_002277422.1| PREDICTED: histone deacetylase HDT1-like [Vitis vinifera] Length = 307 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 4/51 (7%) Frame = -2 Query: 144 VPEKKAKLITPEKI--DGKKSSVHVATPYPSKQAGKTLAN--KPNQPIPKT 4 VP+KKAK +TP+K D KKS HVATPYPSKQAGKT AN KP Q + K+ Sbjct: 226 VPDKKAKFVTPQKTGDDDKKSGGHVATPYPSKQAGKTPANTEKPKQQVQKS 276