BLASTX nr result
ID: Angelica22_contig00020105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00020105 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530836.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002530836.1| conserved hypothetical protein [Ricinus communis] gi|223529600|gb|EEF31549.1| conserved hypothetical protein [Ricinus communis] Length = 280 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 200 LQRKKDHGRAEALLIAAYGKGLKVMPDSSYNLED 99 L+RKKDHGRAEALLIAAYGKGLK+ PD+ +LE+ Sbjct: 245 LKRKKDHGRAEALLIAAYGKGLKLKPDTPCDLEE 278