BLASTX nr result
ID: Angelica22_contig00019588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019588 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein... 67 1e-09 dbj|BAA99575.1| DC2.15 like protein [Daucus carota] 66 3e-09 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] 59 3e-07 ref|XP_002466039.1| hypothetical protein SORBIDRAFT_01g050420 [S... 59 5e-07 emb|CAL07983.1| arachidonic acid-induced DEA1-like protein [Plat... 58 7e-07 >sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor gi|18316|emb|CAA33476.1| unnamed protein product [Daucus carota] Length = 137 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 275 IKANILGIHLNVPIALSLVLNNCGKQVPNGFECT 174 IKANILG +LN+PIALSLVLNNCGKQVPNGFECT Sbjct: 104 IKANILGKNLNLPIALSLVLNNCGKQVPNGFECT 137 >dbj|BAA99575.1| DC2.15 like protein [Daucus carota] Length = 127 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 275 IKANILGIHLNVPIALSLVLNNCGKQVPNGFECT 174 IKANILGI+LN+P+ALSLVLNNCGK +PNGFECT Sbjct: 94 IKANILGINLNLPVALSLVLNNCGKTLPNGFECT 127 >dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] Length = 130 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 275 IKANILGIHLNVPIALSLVLNNCGKQVPNGFEC 177 IKANILGI+LNVP++LSL+LN CGKQVP+GF+C Sbjct: 97 IKANILGINLNVPLSLSLLLNVCGKQVPSGFQC 129 >ref|XP_002466039.1| hypothetical protein SORBIDRAFT_01g050420 [Sorghum bicolor] gi|241919893|gb|EER93037.1| hypothetical protein SORBIDRAFT_01g050420 [Sorghum bicolor] Length = 137 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 275 IKANILGIHLNVPIALSLVLNNCGKQVPNGFECT 174 IKAN+LGIHLN+PI L+LVLN+CGK P GF CT Sbjct: 103 IKANVLGIHLNLPIDLALVLNHCGKTAPKGFHCT 136 >emb|CAL07983.1| arachidonic acid-induced DEA1-like protein [Platanus x acerifolia] Length = 66 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 275 IKANILGIHLNVPIALSLVLNNCGKQVPNGFEC 177 IKA ILGI+LNVP++LSL+LN CGK+VPNGF+C Sbjct: 33 IKAKILGINLNVPVSLSLLLNYCGKKVPNGFQC 65