BLASTX nr result
ID: Angelica22_contig00019265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019265 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279192.1| PREDICTED: leucine-rich repeat extensin-like... 57 2e-06 ref|XP_003575453.1| PREDICTED: pollen-specific leucine-rich repe... 55 6e-06 >ref|XP_002279192.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Vitis vinifera] Length = 394 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 5/56 (8%) Frame = +1 Query: 4 DFKKNCLPDKPDQRTPQECFPVVRNPVNCEAVGC-----RASPLHPSPVDSPPSQP 156 D +KNC+PD+P QR+P+EC + PV+C A GC SP PSP PPS P Sbjct: 332 DDQKNCIPDRPMQRSPEECAAFLAQPVDCGAFGCLPRSPPPSPPPPSPPLPPPSSP 387 >ref|XP_003575453.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1-like [Brachypodium distachyon] Length = 661 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +1 Query: 4 DFKKNCLPDKPDQRTPQECFPVVRNPVNCEAVGCRASPLHPSPVDSP---PSQPK 159 D K NCLP +P Q+TP EC PV+ PV+C C A P P PV P P PK Sbjct: 345 DDKGNCLPGRPAQKTPLECGPVLARPVDCSTNVCSARPSKPKPVYPPVVGPYMPK 399