BLASTX nr result
ID: Angelica22_contig00019214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019214 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638683.1| hypothetical protein MTR_139s0035 [Medicago ... 57 2e-06 ref|XP_003600601.1| Intracellular protease PfpI family [Medicago... 56 3e-06 ref|XP_003600599.1| hypothetical protein MTR_3g064100 [Medicago ... 55 4e-06 ref|XP_003626376.1| hypothetical protein MTR_7g114400 [Medicago ... 54 1e-05 >ref|XP_003638683.1| hypothetical protein MTR_139s0035 [Medicago truncatula] gi|355504618|gb|AES85821.1| hypothetical protein MTR_139s0035 [Medicago truncatula] Length = 341 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 125 WMGSMDDH*GPWPREVTSIALWMGACLRSTQVVEPHS 15 WMGSMDDH GPWPR VTSIAL GA LR +QV +P S Sbjct: 305 WMGSMDDHEGPWPRLVTSIALRRGAYLRCSQVEQPTS 341 >ref|XP_003600601.1| Intracellular protease PfpI family [Medicago truncatula] gi|355489649|gb|AES70852.1| Intracellular protease PfpI family [Medicago truncatula] Length = 282 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 125 WMGSMDDH*GPWPREVTSIALWMGACLRSTQVVE 24 WMGSM D GPWPR+VTSIAL GA LRSTQVVE Sbjct: 9 WMGSMGDQEGPWPRKVTSIALRRGAFLRSTQVVE 42 >ref|XP_003600599.1| hypothetical protein MTR_3g064100 [Medicago truncatula] gi|355489647|gb|AES70850.1| hypothetical protein MTR_3g064100 [Medicago truncatula] Length = 257 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 125 WMGSMDDH*GPWPREVTSIALWMGACLRSTQV 30 WMGSMDD GPWPR+VTSIAL GA LRSTQV Sbjct: 9 WMGSMDDQEGPWPRKVTSIALRRGAFLRSTQV 40 >ref|XP_003626376.1| hypothetical protein MTR_7g114400 [Medicago truncatula] gi|355501391|gb|AES82594.1| hypothetical protein MTR_7g114400 [Medicago truncatula] Length = 81 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 125 WMGSMDDH*GPWPREVTSIALWMGACLRSTQVVEP 21 WMGSM DH G WPR+VTSIAL G LRS QVVEP Sbjct: 45 WMGSMGDHEGLWPRKVTSIALRRGVFLRSIQVVEP 79