BLASTX nr result
ID: Angelica22_contig00019167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019167 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262853.2| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_002322749.1| predicted protein [Populus trichocarpa] gi|2... 88 6e-16 ref|XP_002517927.1| pentatricopeptide repeat-containing protein,... 87 1e-15 ref|XP_004137019.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 ref|XP_002339288.1| predicted protein [Populus trichocarpa] gi|2... 83 3e-14 >ref|XP_002262853.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Vitis vinifera] Length = 494 Score = 99.8 bits (247), Expect = 2e-19 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 1/94 (1%) Frame = -2 Query: 281 IGYYCRKGLMEKAEALLDRA-KRDGKPLPQTWYYFATGYIGSGQLPKAVEAMKRAISKCR 105 I YCRKGL EKAEAL+++ + G PL TW+Y A GY+ Q+PKAVEA+K+A+ C Sbjct: 367 IDAYCRKGLTEKAEALVNKILTKGGNPLVDTWFYLANGYLEDSQIPKAVEALKKAVVVCP 426 Query: 104 RGWKQPSTDILIACLEYLKKNKDVKEVEEFIRSL 3 WK PS + L CLEYL+ N+DV+ EFIR L Sbjct: 427 PNWK-PSKNTLATCLEYLEGNRDVEGAGEFIRFL 459 >ref|XP_002322749.1| predicted protein [Populus trichocarpa] gi|222867379|gb|EEF04510.1| predicted protein [Populus trichocarpa] Length = 505 Score = 88.2 bits (217), Expect = 6e-16 Identities = 47/91 (51%), Positives = 62/91 (68%), Gaps = 1/91 (1%) Frame = -2 Query: 281 IGYYCRKGLMEKAEALLDRA-KRDGKPLPQTWYYFATGYIGSGQLPKAVEAMKRAISKCR 105 I Y RKGL+EKAE L+DRA + G+P +TWY+ ATGY+ +GQ KAVEAMK+A+ Sbjct: 379 IDAYSRKGLVEKAETLIDRAISKGGEPNAKTWYHLATGYLQNGQTLKAVEAMKKAVVVSG 438 Query: 104 RGWKQPSTDILIACLEYLKKNKDVKEVEEFI 12 R WK PS +IL CL YLK D+ ++ F+ Sbjct: 439 RMWK-PSNEILANCLGYLKVEGDLGKLTNFM 468 >ref|XP_002517927.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542909|gb|EEF44445.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 87.0 bits (214), Expect = 1e-15 Identities = 43/90 (47%), Positives = 56/90 (62%) Frame = -2 Query: 272 YCRKGLMEKAEALLDRAKRDGKPLPQTWYYFATGYIGSGQLPKAVEAMKRAISKCRRGWK 93 YCRKGL KAEA +A P TW A YIG Q+ KAVE +K+AIS R+GWK Sbjct: 370 YCRKGLYTKAEAAFKKAAEGRTPYASTWITMAMSYIGQNQMSKAVEMLKKAISVSRKGWK 429 Query: 92 QPSTDILIACLEYLKKNKDVKEVEEFIRSL 3 P+ L CL+YL++ DV+ +EE ++SL Sbjct: 430 -PNPITLTTCLDYLEEQGDVEGIEEIVKSL 458 >ref|XP_004137019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] gi|449479168|ref|XP_004155524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 500 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/88 (45%), Positives = 58/88 (65%) Frame = -2 Query: 272 YCRKGLMEKAEALLDRAKRDGKPLPQTWYYFATGYIGSGQLPKAVEAMKRAISKCRRGWK 93 YCRKGL++KAE+++++A + P TW ATGY G + KAVE +K+AI R+ WK Sbjct: 358 YCRKGLLDKAESVVNQAVVERTPFRSTWSILATGYAEYGHMSKAVEMLKKAILVGRQNWK 417 Query: 92 QPSTDILIACLEYLKKNKDVKEVEEFIR 9 DIL ACL+YL+K D + ++E +R Sbjct: 418 PKQGDILEACLDYLEKQGDAETMDEIVR 445 >ref|XP_002339288.1| predicted protein [Populus trichocarpa] gi|222874812|gb|EEF11943.1| predicted protein [Populus trichocarpa] Length = 140 Score = 82.8 bits (203), Expect = 3e-14 Identities = 42/89 (47%), Positives = 61/89 (68%), Gaps = 1/89 (1%) Frame = -2 Query: 266 RKGLMEKAEALLDRA-KRDGKPLPQTWYYFATGYIGSGQLPKAVEAMKRAISKCRRGWKQ 90 ++GL+EK E L+DRA G P +TWY+F TGY+ +GQ KA+EAMK+ + R WK Sbjct: 14 QEGLVEKVETLIDRAISIGGDPNAKTWYHFETGYLRNGQTLKAMEAMKKEVVVSGRRWK- 72 Query: 89 PSTDILIACLEYLKKNKDVKEVEEFIRSL 3 PS + L CLEYLK+ D+++V++F+ L Sbjct: 73 PSNESLATCLEYLKEEGDLEKVKDFMELL 101