BLASTX nr result
ID: Angelica22_contig00019163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019163 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001150575.1| transcription elongation factor SPT4 [Zea ma... 58 7e-07 ref|XP_002315361.1| predicted protein [Populus trichocarpa] gi|1... 58 7e-07 ref|XP_002270173.1| PREDICTED: transcription elongation factor S... 58 7e-07 ref|XP_002513156.1| suppressor of ty, putative [Ricinus communis... 57 1e-06 ref|XP_002463206.1| hypothetical protein SORBIDRAFT_02g039750 [S... 57 2e-06 >ref|NP_001150575.1| transcription elongation factor SPT4 [Zea mays] gi|195640310|gb|ACG39623.1| transcription elongation factor SPT4 [Zea mays] gi|414590937|tpg|DAA41508.1| TPA: transcription elongation factor SPT4 [Zea mays] Length = 129 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = -1 Query: 189 GSLFADQGIAG--QIPMSFGPELGACFCCRNGKTYEQFWELGCCENCPFPKM---NDDLV 25 G + D+ G +IP SFGPEL AC CR KTY+QF E G CENCPF +M +D++V Sbjct: 7 GGMMDDEERVGHAEIPTSFGPELRACLRCRLVKTYDQFRENG-CENCPFLEMDREHDNVV 65 Query: 24 NLT 16 N T Sbjct: 66 NCT 68 >ref|XP_002315361.1| predicted protein [Populus trichocarpa] gi|118489920|gb|ABK96757.1| unknown [Populus trichocarpa x Populus deltoides] gi|222864401|gb|EEF01532.1| predicted protein [Populus trichocarpa] Length = 116 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 162 AGQIPMSFGPELGACFCCRNGKTYEQFWELGCCENCPFPKMNDD 31 A QIP SFG EL AC CR KTY+QF E G CENCPF KM++D Sbjct: 5 AAQIPTSFGHELRACLRCRLVKTYDQFRESG-CENCPFFKMDED 47 >ref|XP_002270173.1| PREDICTED: transcription elongation factor SPT4 homolog 2 [Vitis vinifera] gi|297742714|emb|CBI35348.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 162 AGQIPMSFGPELGACFCCRNGKTYEQFWELGCCENCPFPKMNDD 31 A QIP SFG EL AC CR KTY+QF E G CENCPF KM++D Sbjct: 4 AAQIPTSFGHELRACLRCRLVKTYDQFRESG-CENCPFFKMDED 46 >ref|XP_002513156.1| suppressor of ty, putative [Ricinus communis] gi|223548167|gb|EEF49659.1| suppressor of ty, putative [Ricinus communis] Length = 116 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -1 Query: 165 IAGQIPMSFGPELGACFCCRNGKTYEQFWELGCCENCPFPKMNDD 31 + QIP SFG EL AC CR KTY+QF E G CENCPF KM++D Sbjct: 4 VPAQIPTSFGHELRACLRCRLVKTYDQFRESG-CENCPFFKMDED 47 >ref|XP_002463206.1| hypothetical protein SORBIDRAFT_02g039750 [Sorghum bicolor] gi|241926583|gb|EER99727.1| hypothetical protein SORBIDRAFT_02g039750 [Sorghum bicolor] Length = 128 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = -1 Query: 189 GSLFADQGIAG--QIPMSFGPELGACFCCRNGKTYEQFWELGCCENCPFPKM---NDDLV 25 G + D+ G +IP SFGPEL AC CR KTY+QF + G CENCPF +M +D++V Sbjct: 6 GGMMDDEERVGHAEIPTSFGPELRACLRCRLVKTYDQFRQNG-CENCPFLEMEREHDNVV 64 Query: 24 NLT 16 N T Sbjct: 65 NCT 67