BLASTX nr result
ID: Angelica22_contig00019138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019138 (832 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006234333.1| ORF127_2 gene product (mitochondrion) [Huper... 48 8e-06 >ref|YP_006234333.1| ORF127_2 gene product (mitochondrion) [Huperzia squarrosa] gi|359741484|gb|AEV55832.1| hypothetical protein HusqMp92 (mitochondrion) [Huperzia squarrosa] Length = 127 Score = 48.1 bits (113), Expect(2) = 8e-06 Identities = 36/80 (45%), Positives = 45/80 (56%) Frame = -2 Query: 744 QTSLRDETPAQGPQFSLGGRTKDLWKSGLPRPYGQRNSVLREEFRGLIVARTFLLSRSCE 565 + SLRD+TPAQGP+FS K G P+ +SVLR EFRGLIV +TF S + Sbjct: 17 RASLRDQTPAQGPKFSRVKPQFGPRKVGANHPH---DSVLR-EFRGLIVTQTF--SGHAK 70 Query: 564 GGQSKIVLFLYKDNRRSQRL 505 G + NRRSQR+ Sbjct: 71 GASPRSYCSSLFCNRRSQRI 90 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 778 ALEEPRGTPYRAN 740 ALEEP+GTPYRA+ Sbjct: 7 ALEEPQGTPYRAS 19