BLASTX nr result
ID: Angelica22_contig00019057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019057 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL99109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygena... 57 2e-06 ref|NP_001031794.1| oxidoreductase, 2OG-Fe(II) oxygenase family ... 57 2e-06 ref|NP_195332.2| oxidoreductase, 2OG-Fe(II) oxygenase family pro... 57 2e-06 ref|NP_001031793.1| oxidoreductase, 2OG-Fe(II) oxygenase family ... 57 2e-06 emb|CAA18503.1| hypothetical protein [Arabidopsis thaliana] gi|7... 57 2e-06 >gb|AEL99109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein, partial [Silene latifolia] gi|343172814|gb|AEL99110.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein, partial [Silene latifolia] Length = 261 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 380 SFLTESNILFGSNLKISGPGEFEGRISIPLPVG 282 SFLTE NI+FG+NLK+ GPGEF G ++IPLPVG Sbjct: 176 SFLTECNIMFGTNLKVEGPGEFSGPVTIPLPVG 208 >ref|NP_001031794.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|55819794|gb|AAV66092.1| At4g36090 [Arabidopsis thaliana] gi|59958356|gb|AAX12888.1| At4g36090 [Arabidopsis thaliana] gi|332661217|gb|AEE86617.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 520 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 380 SFLTESNILFGSNLKISGPGEFEGRISIPLPVG 282 SFL+E NILFGSNLK+ GPGEF G SIPLPVG Sbjct: 353 SFLSECNILFGSNLKVLGPGEFSGSYSIPLPVG 385 >ref|NP_195332.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|332661215|gb|AEE86615.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 385 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 380 SFLTESNILFGSNLKISGPGEFEGRISIPLPVG 282 SFL+E NILFGSNLK+ GPGEF G SIPLPVG Sbjct: 353 SFLSECNILFGSNLKVLGPGEFSGSYSIPLPVG 385 >ref|NP_001031793.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|51971445|dbj|BAD44387.1| hypothetical protein [Arabidopsis thaliana] gi|332661216|gb|AEE86616.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 452 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 380 SFLTESNILFGSNLKISGPGEFEGRISIPLPVG 282 SFL+E NILFGSNLK+ GPGEF G SIPLPVG Sbjct: 285 SFLSECNILFGSNLKVLGPGEFSGSYSIPLPVG 317 >emb|CAA18503.1| hypothetical protein [Arabidopsis thaliana] gi|7270561|emb|CAB81518.1| hypothetical protein [Arabidopsis thaliana] Length = 505 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 380 SFLTESNILFGSNLKISGPGEFEGRISIPLPVG 282 SFL+E NILFGSNLK+ GPGEF G SIPLPVG Sbjct: 338 SFLSECNILFGSNLKVLGPGEFSGSYSIPLPVG 370