BLASTX nr result
ID: Angelica22_contig00019045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00019045 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21459.3| unnamed protein product [Vitis vinifera] 68 7e-10 ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 62 3e-08 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 56 3e-06 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +2 Query: 5 AIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFLCIGLF 121 AIRTRTVD LGKT QT YYQNDLNCFKDPTC F +G F Sbjct: 39 AIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIFFALGSF 77 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 5 AIRTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFL 106 AIRTRTVD LGKT +T+YY+NDLNCFKDPTC L Sbjct: 58 AIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCILL 91 Score = 20.4 bits (41), Expect(2) = 3e-08 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 106 VHWALSLTD 132 +HWALS TD Sbjct: 91 LHWALSSTD 99 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 11 RTRTVDFLGKTYQTFYYQNDLNCFKDPTCNFL 106 R RTVD LGKT QT YY+ND NCFKDPTC FL Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTCIFL 41