BLASTX nr result
ID: Angelica22_contig00018617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00018617 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53232.1| JHL06P13.13 [Jatropha curcas] 62 4e-08 >dbj|BAJ53232.1| JHL06P13.13 [Jatropha curcas] Length = 444 Score = 62.4 bits (150), Expect = 4e-08 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 233 IWSVRRFVEWRPCDWWIRGHLNDNCIWFYV 322 IWSVRR VEWRPC WW++GHL DN WF+V Sbjct: 49 IWSVRRIVEWRPCKWWLQGHLTDNLYWFFV 78