BLASTX nr result
ID: Angelica22_contig00018432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00018432 (1241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516752.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 81 6e-13 ref|XP_003537614.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 79 3e-12 ref|XP_004134129.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 77 1e-11 emb|CBI26285.3| unnamed protein product [Vitis vinifera] 75 3e-11 ref|XP_002279035.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 75 3e-11 >ref|XP_003516752.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Length = 600 Score = 80.9 bits (198), Expect = 6e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -3 Query: 417 IQVQHYERLSPLVPLNVPLGSFSNIRTGDCIVTFSRREIYNLKVR 283 I+VQ YERLSPLVPLNVPLGSFSN+R GDCIVTFSR+EIY LK R Sbjct: 245 IEVQFYERLSPLVPLNVPLGSFSNVRNGDCIVTFSRQEIYKLKKR 289 >ref|XP_003537614.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Length = 565 Score = 78.6 bits (192), Expect = 3e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -3 Query: 417 IQVQHYERLSPLVPLNVPLGSFSNIRTGDCIVTFSRREIYNLKVR 283 I+VQ YERLSPLVPL VPLGSFSN+R GDCIVTFSR+EIY LK R Sbjct: 210 IEVQFYERLSPLVPLKVPLGSFSNVRNGDCIVTFSRQEIYKLKKR 254 >ref|XP_004134129.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus] gi|449504169|ref|XP_004162271.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus] Length = 560 Score = 76.6 bits (187), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 417 IQVQHYERLSPLVPLNVPLGSFSNIRTGDCIVTFSRREIYNLK 289 I+VQ+YERLSPL+PLN+PLGS+SNIR GDCIVTFSRR IY K Sbjct: 202 IEVQYYERLSPLIPLNIPLGSYSNIRKGDCIVTFSRRRIYGYK 244 >emb|CBI26285.3| unnamed protein product [Vitis vinifera] Length = 612 Score = 75.5 bits (184), Expect = 3e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 414 QVQHYERLSPLVPLNVPLGSFSNIRTGDCIVTFSRREIYNLK 289 +VQ+YERLSPLVPLNVPL SFS+I+TGDCIVTFSRR+IY LK Sbjct: 258 EVQYYERLSPLVPLNVPLRSFSDIQTGDCIVTFSRRQIYKLK 299 >ref|XP_002279035.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Vitis vinifera] Length = 572 Score = 75.5 bits (184), Expect = 3e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 414 QVQHYERLSPLVPLNVPLGSFSNIRTGDCIVTFSRREIYNLK 289 +VQ+YERLSPLVPLNVPL SFS+I+TGDCIVTFSRR+IY LK Sbjct: 218 EVQYYERLSPLVPLNVPLRSFSDIQTGDCIVTFSRRQIYKLK 259