BLASTX nr result
ID: Angelica22_contig00018038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00018038 (564 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 59 3e-10 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 57 3e-08 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 50 7e-06 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 55 8e-06 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 58.9 bits (141), Expect(2) = 3e-10 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +2 Query: 194 SCGMLVLGATTYDIHRSIKNNSKPPTEQEMQELNDYIKS 310 + GM+ GATTYD+HRSIKNN +PPT ++M+ L DYI S Sbjct: 703 AAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 Score = 30.8 bits (68), Expect(2) = 3e-10 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 34 RRKMRIFGKHMFPSQFIILSA 96 R MR+FGKH+FP Q ++ +A Sbjct: 684 RGSMRLFGKHVFPRQIVLFAA 704 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = +2 Query: 200 GMLVLGATTYDIHRSIKNNSKPPTEQEMQELNDYIKSLR 316 G+L L +TTYD+HRSIKNN PP+E++++ L +YIKS+R Sbjct: 19 GLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVR 57 Score = 25.8 bits (55), Expect(2) = 3e-08 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 43 MRIFGKHMFPSQFIILSA 96 MRIFGK +FP Q I+ ++ Sbjct: 1 MRIFGKPVFPRQIILFAS 18 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 50.4 bits (119), Expect(2) = 7e-06 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = +2 Query: 191 VSCGMLVLGATTYDIHRSIKNNSKPPTEQEMQELNDYIKS 310 ++ G++ GATTYD+HRSIKNN +PPT +++ L +I S Sbjct: 16 LAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDS 55 Score = 24.6 bits (52), Expect(2) = 7e-06 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 43 MRIFGKHMFPSQFIILSA 96 MR+ G+H+ P Q ++L+A Sbjct: 1 MRLLGRHVSPRQIVLLAA 18 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +2 Query: 194 SCGMLVLGATTYDIHRSIKNNSKPPTEQEMQELNDYIKS 310 + G++ GATTYD+HRSIKNN +PPT ++M+ L YI S Sbjct: 17 AAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDS 55