BLASTX nr result
ID: Angelica22_contig00017963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017963 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521767.1| leucine-rich repeat-containing protein, puta... 57 2e-06 ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus ... 54 1e-05 >ref|XP_002521767.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223538980|gb|EEF40577.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 994 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 5/76 (6%) Frame = +1 Query: 1 RHFNAKILERMPNLRLLEIIGTHD-----VKGDFKNVLLELRCIRWSHCPWKCLPSSFHP 165 + F+ + +M NLRLL++ G + + GDF+ + +L+C+ W P K LPS+F+P Sbjct: 325 KKFSVEAFMKMKNLRLLDVHGAYGDRKIHLSGDFEFLYYKLKCLCWEGYPLKYLPSNFNP 384 Query: 166 PKLVSLHMPCSDLRTL 213 K++ L MP S ++ L Sbjct: 385 KKIIMLEMPQSSIKRL 400 >ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus communis] gi|223545855|gb|EEF47358.1| TMV resistance protein N, putative [Ricinus communis] Length = 1082 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/71 (36%), Positives = 43/71 (60%) Frame = +1 Query: 1 RHFNAKILERMPNLRLLEIIGTHDVKGDFKNVLLELRCIRWSHCPWKCLPSSFHPPKLVS 180 +H +AK +M LRLL++ + G + + +LR + W P++ LPS+F P KLV Sbjct: 543 KHLSAKAFMKMRKLRLLKLRNVR-LSGSLEYLSNKLRYLEWEEYPFRSLPSTFQPDKLVE 601 Query: 181 LHMPCSDLRTL 213 LH+P S+++ L Sbjct: 602 LHLPSSNIQQL 612