BLASTX nr result
ID: Angelica22_contig00017764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017764 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO32530.1| cytochrome P450-dependent monooxygenase-like prot... 58 9e-07 >gb|ABO32530.1| cytochrome P450-dependent monooxygenase-like protein [Ammi majus] Length = 507 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 277 EDLDMDETFGATTKRKNSLFLNVTPHISSL 188 EDLDMDETFGATTKRKNSL LNVT HISSL Sbjct: 476 EDLDMDETFGATTKRKNSLVLNVTSHISSL 505