BLASTX nr result
ID: Angelica22_contig00017632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017632 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518185.1| glutathione s-transferase, putative [Ricinus... 73 3e-11 ref|XP_002523996.1| glutathione s-transferase, putative [Ricinus... 73 3e-11 ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum l... 72 5e-11 gb|AGC13132.1| tau class glutathione S-transferase [Pinus tabuli... 71 8e-11 gb|AGC13127.1| tau class glutathione S-transferase [Pinus tabuli... 71 1e-10 >ref|XP_002518185.1| glutathione s-transferase, putative [Ricinus communis] gi|223542781|gb|EEF44318.1| glutathione s-transferase, putative [Ricinus communis] Length = 227 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 158 YFEPSILTNKSPLLLQYNPVHKKIPVLVHNGKPVCESLVILESL 27 Y E L+NKSPLLLQYNPVH+KIPVL+H GKP+CES+VI+E L Sbjct: 31 YIEEEDLSNKSPLLLQYNPVHRKIPVLLHGGKPICESMVIIEYL 74 >ref|XP_002523996.1| glutathione s-transferase, putative [Ricinus communis] gi|223536723|gb|EEF38364.1| glutathione s-transferase, putative [Ricinus communis] Length = 219 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 140 LTNKSPLLLQYNPVHKKIPVLVHNGKPVCESLVILE 33 LTNKSPLLLQYNPVHKKIPVLVHNGKP+ ESLVILE Sbjct: 37 LTNKSPLLLQYNPVHKKIPVLVHNGKPIVESLVILE 72 >ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum] gi|10567808|gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum] Length = 225 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 155 FEPSILTNKSPLLLQYNPVHKKIPVLVHNGKPVCESLVILE 33 ++ L+NKSPLLLQYNPVHKKIPVLVHNGKP+ ESLVILE Sbjct: 33 YQEEDLSNKSPLLLQYNPVHKKIPVLVHNGKPIAESLVILE 73 >gb|AGC13132.1| tau class glutathione S-transferase [Pinus tabuliformis] Length = 234 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 167 HTSYFEPSILTNKSPLLLQYNPVHKKIPVLVHNGKPVCESLVILE 33 H + E +L NKS LLLQ NPVHKKIPVL+HNGKPVCES++I++ Sbjct: 34 HCEFIEEDVLNNKSELLLQSNPVHKKIPVLIHNGKPVCESMIIVQ 78 >gb|AGC13127.1| tau class glutathione S-transferase [Pinus tabuliformis] Length = 232 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 167 HTSYFEPSILTNKSPLLLQYNPVHKKIPVLVHNGKPVCESLVILE 33 H + E +L NKS LLLQ NPVHKKIPVL+HNGKPVCES++I++ Sbjct: 34 HYEFIEEEVLNNKSELLLQSNPVHKKIPVLIHNGKPVCESMIIVQ 78