BLASTX nr result
ID: Angelica22_contig00017331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017331 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600971.1| Multiple inositol polyphosphate phosphatase ... 68 9e-10 ref|XP_002520778.1| Multiple inositol polyphosphate phosphatase ... 65 7e-09 ref|XP_003552236.1| PREDICTED: thiamine-repressible acid phospha... 64 1e-08 ref|XP_003524603.1| PREDICTED: uncharacterized protein LOC100815... 64 2e-08 emb|CBI25430.3| unnamed protein product [Vitis vinifera] 64 2e-08 >ref|XP_003600971.1| Multiple inositol polyphosphate phosphatase [Medicago truncatula] gi|355490019|gb|AES71222.1| Multiple inositol polyphosphate phosphatase [Medicago truncatula] Length = 575 Score = 67.8 bits (164), Expect = 9e-10 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -1 Query: 334 GCNNSNICPYEVFKERIAAPHLKHDYNRVCNAEKPYKHKSTLTTRMFSWLF 182 GC+ S+ CP+EVFKE+I APH KHDY+ VCNA+ K ++ ++F WLF Sbjct: 514 GCHGSDFCPFEVFKEKIVAPHQKHDYDTVCNAKLEPKSSRSMIFQIFQWLF 564 >ref|XP_002520778.1| Multiple inositol polyphosphate phosphatase 1 precursor, putative [Ricinus communis] gi|223539909|gb|EEF41487.1| Multiple inositol polyphosphate phosphatase 1 precursor, putative [Ricinus communis] Length = 493 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/55 (49%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = -1 Query: 334 GCNNSNICPYEVFKERIAAPHLKHDYNRVCNA---EKPYKHKSTLTTRMFSWLFA 179 GCNNS+ CP+EVFKE I APH+KH++N VC E K +++ +++F WLF+ Sbjct: 426 GCNNSDFCPFEVFKETIVAPHIKHEFNAVCAVKLEEPEQKPETSKLSQLFRWLFS 480 >ref|XP_003552236.1| PREDICTED: thiamine-repressible acid phosphatase pho4-like [Glycine max] Length = 494 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -1 Query: 334 GCNNSNICPYEVFKERIAAPHLKHDYNRVCNAEKPYKHKSTLTTRMFSWLFA 179 GC+ S+ CP+EVFKE+I APH KHDY+ VCN + + ++F WLF+ Sbjct: 431 GCDGSDFCPFEVFKEKIVAPHQKHDYHTVCNEKLEQEPSGNKVFQIFQWLFS 482 >ref|XP_003524603.1| PREDICTED: uncharacterized protein LOC100815749 [Glycine max] Length = 492 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -1 Query: 334 GCNNSNICPYEVFKERIAAPHLKHDYNRVCNAEKPYKHKSTLTTRMFSWL 185 GC+ S+ CP+EVFKE+I APH KHDY+ VCNA+ + + ++F WL Sbjct: 431 GCDGSDFCPFEVFKEKIVAPHQKHDYHTVCNAKLEQEPSGSKVFQIFKWL 480 >emb|CBI25430.3| unnamed protein product [Vitis vinifera] Length = 556 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = -1 Query: 334 GCNNSNICPYEVFKERIAAPHLKHDYNRVCNA--EKPYKHKSTLTT 203 GC+NS++CP+EVFKERI PH+KH+Y VCN EKP + +T TT Sbjct: 507 GCDNSDLCPFEVFKERIVTPHMKHEYYAVCNVKLEKPEQKPATTTT 552