BLASTX nr result
ID: Angelica22_contig00017316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017316 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514091.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002514091.1| conserved hypothetical protein [Ricinus communis] gi|223546547|gb|EEF48045.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 124 QNATIEGDHS-KTGLELVKSASDKHLDLLRPSARYFSMTKGQ 2 QN IE +TGLELVKSASDKH+DLLRPSARY+S +KGQ Sbjct: 3 QNIAIEEKECLRTGLELVKSASDKHIDLLRPSARYYSASKGQ 44