BLASTX nr result
ID: Angelica22_contig00017220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017220 (863 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24510.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_002268371.1| PREDICTED: cleavage and polyadenylation spec... 67 4e-09 emb|CAN63685.1| hypothetical protein VITISV_020449 [Vitis vinifera] 67 5e-09 ref|XP_004152876.1| PREDICTED: cleavage and polyadenylation spec... 66 9e-09 ref|XP_003548242.1| PREDICTED: cleavage and polyadenylation spec... 63 8e-08 >emb|CBI24510.3| unnamed protein product [Vitis vinifera] Length = 1448 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 112 RSNFSLELDAANATWLSNDVAMLSTKTGELLLLKLVY 2 RS+FS+ELDAANATWLSNDVAMLSTKTGELLLL L Y Sbjct: 357 RSSFSVELDAANATWLSNDVAMLSTKTGELLLLTLAY 393 >ref|XP_002268371.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like [Vitis vinifera] Length = 1442 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 112 RSNFSLELDAANATWLSNDVAMLSTKTGELLLLKLVY 2 RS+FS+ELDAANATWLSNDVAMLSTKTGELLLL L Y Sbjct: 357 RSSFSVELDAANATWLSNDVAMLSTKTGELLLLTLAY 393 >emb|CAN63685.1| hypothetical protein VITISV_020449 [Vitis vinifera] Length = 64 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 112 RSNFSLELDAANATWLSNDVAMLSTKTGELLLLKLVY 2 RS+FS+ELDAANATWLSNDVAMLSTKTGELLLL L Y Sbjct: 3 RSSFSVELDAANATWLSNDVAMLSTKTGELLLLTLXY 39 >ref|XP_004152876.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like [Cucumis sativus] Length = 1504 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 112 RSNFSLELDAANATWLSNDVAMLSTKTGELLLLKLVY 2 RSNF++ELDAANATWL NDVA+LSTKTGELLLL LVY Sbjct: 356 RSNFNVELDAANATWLVNDVALLSTKTGELLLLALVY 392 >ref|XP_003548242.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like [Glycine max] Length = 1447 Score = 63.2 bits (152), Expect = 8e-08 Identities = 35/72 (48%), Positives = 48/72 (66%) Frame = -2 Query: 217 LLAFAASLHEFLLYSGAVTDILSYCLI*NLCLK*KRSNFSLELDAANATWLSNDVAMLST 38 L+ A ++H + + SY + + + RS+F++ELDAANATWL +DVA+LST Sbjct: 318 LVISANTIHYHSQSASCALALNSYAVTLDSSQEIPRSSFNVELDAANATWLLSDVALLST 377 Query: 37 KTGELLLLKLVY 2 KTGELLLL LVY Sbjct: 378 KTGELLLLTLVY 389