BLASTX nr result
ID: Angelica22_contig00017163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00017163 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vit... 63 3e-08 ref|XP_002319447.1| cytochrome P450 probable ent-kaurenoic acid ... 61 8e-08 ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinu... 59 4e-07 gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum] 59 5e-07 ref|XP_002321248.1| cytochrome P450 probable ent-kaurenoic acid ... 59 5e-07 >ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera] Length = 492 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = -1 Query: 151 IEMGMGLVVFVAIFC-VLGL---LRRANGWFYDYKLGEKCYELPPGDMGWPFIG 2 +E+GM V F AI VLG+ LRRAN W Y+ KLGEK Y LPPGD+GWP IG Sbjct: 1 MELGMIWVAFGAILGGVLGVKWVLRRANSWVYEVKLGEKRYSLPPGDLGWPLIG 54 >ref|XP_002319447.1| cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] gi|222857823|gb|EEE95370.1| cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] Length = 490 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/54 (57%), Positives = 36/54 (66%), Gaps = 6/54 (11%) Frame = -1 Query: 145 MGMGL--VVFVAIFCVLG----LLRRANGWFYDYKLGEKCYELPPGDMGWPFIG 2 MG+G VV V IFC LG +L+R N W Y+ KLG K LPPGD+GWPFIG Sbjct: 1 MGLGSIWVVLVVIFCGLGVGQWILKRVNWWLYEAKLGAKKDSLPPGDLGWPFIG 54 >ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] gi|223534199|gb|EEF35915.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] Length = 492 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = -1 Query: 151 IEMGMGLVVFVAI----FCVLGLLRRANGWFYDYKLGEKCYELPPGDMGWPFIG 2 +EMG VV + I +C+ +L+R N W Y+ +LGE Y LPPGD+GWPFIG Sbjct: 1 MEMGFVWVVLIWISGGFWCLKWILKRVNCWLYENQLGEMQYSLPPGDLGWPFIG 54 >gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum] Length = 488 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/55 (52%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = -1 Query: 154 MIEMGMGLVVFVAIFCVL----GLLRRANGWFYDYKLGEKCYELPPGDMGWPFIG 2 ++EMG VV +AI L +L+ N W Y+ KLG K Y LPPGDMGWPFIG Sbjct: 2 ILEMGSMWVVLMAIGGALLVLRSILKNVNWWLYESKLGVKQYSLPPGDMGWPFIG 56 >ref|XP_002321248.1| cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] gi|222862021|gb|EEE99563.1| cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] Length = 493 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = -1 Query: 151 IEMGMGLVVFVAIFCVLG----LLRRANGWFYDYKLGEKCYELPPGDMGWPFIG 2 +E G VV IF LG +L++ N W Y+ +LGEK Y LPPGD+GWPFIG Sbjct: 1 MESGSIWVVLAVIFGGLGVGKWILKKVNWWLYEAQLGEKQYSLPPGDLGWPFIG 54