BLASTX nr result
ID: Angelica22_contig00016611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00016611 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 97 1e-18 ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthe... 96 2e-18 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 96 2e-18 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 96 2e-18 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 96 2e-18 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 97.4 bits (241), Expect = 1e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -3 Query: 325 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWAPGHKQWMN 191 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKW PGHKQW N Sbjct: 566 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQWGN 610 >ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine max] Length = 609 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -3 Query: 325 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWAPGHKQWMNIKSS 179 SINQYKTPRCVKFAP++ELLNSRVV YFSPKCPKW PGHKQW+N SS Sbjct: 561 SINQYKTPRCVKFAPVLELLNSRVVEKYFSPKCPKWVPGHKQWINQNSS 609 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 325 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWAPGHKQWMN 191 SINQYKTPRCVKFAPI+ELLNSRVVS+YFSPKCPKW PGHKQW N Sbjct: 523 SINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCN 567 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 325 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWAPGHKQWMN 191 SINQYKTPRCVKFAPI+ELLNSRVVS+YFSPKCPKW PGHKQW N Sbjct: 550 SINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCN 594 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 325 SINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWAPGHKQWMN 191 SINQYKTPRCVKFAPI+ELLNSRVVS+YFSPKCPKW PGHKQW N Sbjct: 567 SINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCN 611