BLASTX nr result
ID: Angelica22_contig00016530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00016530 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas] 70 1e-10 dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas] 70 2e-10 gb|AFP74112.1| poly-A binding protein, partial [Nicotiana bentha... 69 4e-10 gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana taba... 69 4e-10 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana taba... 69 4e-10 >dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas] Length = 642 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +3 Query: 3 TEVLHLLESPEALQAKVAEALEVLRTVTQQTGTPVHQLSTLSLRDGLVS 149 TEVLHLLESPE+L+AKVAEA+EVLRTV QQ +P +++TLSL D LVS Sbjct: 594 TEVLHLLESPESLKAKVAEAMEVLRTVQQQVNSPTDRMATLSLNDSLVS 642 >dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas] Length = 642 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = +3 Query: 3 TEVLHLLESPEALQAKVAEALEVLRTVTQQTGTPVHQLSTLSLRDGLVS 149 TEVLHLLESPE+L+AKVAEA+EVLRTV QQ +P ++++TLSL + LVS Sbjct: 594 TEVLHLLESPESLEAKVAEAMEVLRTVQQQANSPTNRMATLSLNENLVS 642 >gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana] Length = 643 Score = 68.9 bits (167), Expect = 4e-10 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +3 Query: 3 TEVLHLLESPEALQAKVAEALEVLRTVT-QQTGTPVHQLSTLSLRDGLVS 149 TEVLHLLESPEAL+AKVAEA+EVLR V+ QQ+ P QL++LSL DGLVS Sbjct: 594 TEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS 643 >gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana tabacum] Length = 330 Score = 68.9 bits (167), Expect = 4e-10 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +3 Query: 3 TEVLHLLESPEALQAKVAEALEVLRTVT-QQTGTPVHQLSTLSLRDGLVS 149 TEVLHLLESPEAL+AKVAEA+EVLR V+ QQ+ P QL++LSL DGLVS Sbjct: 281 TEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS 330 >gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum] Length = 649 Score = 68.9 bits (167), Expect = 4e-10 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +3 Query: 3 TEVLHLLESPEALQAKVAEALEVLRTVT-QQTGTPVHQLSTLSLRDGLVS 149 TEVLHLLESPEAL+AKVAEA+EVLR V+ QQ+ P QL++LSL DGLVS Sbjct: 600 TEVLHLLESPEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS 649