BLASTX nr result
ID: Angelica22_contig00016527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00016527 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003560276.1| PREDICTED: signal peptide peptidase-like 2B-... 99 3e-19 gb|AFW69667.1| hypothetical protein ZEAMMB73_283504 [Zea mays] 97 1e-18 gb|AFW69666.1| hypothetical protein ZEAMMB73_283504 [Zea mays] 97 1e-18 dbj|BAJ97624.1| predicted protein [Hordeum vulgare subsp. vulgare] 97 1e-18 dbj|BAK08187.1| predicted protein [Hordeum vulgare subsp. vulgare] 97 1e-18 >ref|XP_003560276.1| PREDICTED: signal peptide peptidase-like 2B-like [Brachypodium distachyon] Length = 629 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -2 Query: 455 GLLVTYLALNLMDGHGQPALLYIVPFMLGTLLTLGNKQRELENLWNKGEPERICQH 288 GLL+TY+ALNLMDGHGQPALLYIVPF LGTL+ LG K+REL NLW KGEPER+C H Sbjct: 551 GLLITYVALNLMDGHGQPALLYIVPFTLGTLILLGWKRRELRNLWFKGEPERVCTH 606 >gb|AFW69667.1| hypothetical protein ZEAMMB73_283504 [Zea mays] Length = 399 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -2 Query: 455 GLLVTYLALNLMDGHGQPALLYIVPFMLGTLLTLGNKQRELENLWNKGEPERICQH 288 GLL+TY+ALNLMDGHGQPALLYIVPF LGTL+ LG K+ EL+NLW +GEPER+C H Sbjct: 333 GLLITYVALNLMDGHGQPALLYIVPFTLGTLIALGWKRGELQNLWARGEPERVCTH 388 >gb|AFW69666.1| hypothetical protein ZEAMMB73_283504 [Zea mays] Length = 338 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -2 Query: 455 GLLVTYLALNLMDGHGQPALLYIVPFMLGTLLTLGNKQRELENLWNKGEPERICQH 288 GLL+TY+ALNLMDGHGQPALLYIVPF LGTL+ LG K+ EL+NLW +GEPER+C H Sbjct: 272 GLLITYVALNLMDGHGQPALLYIVPFTLGTLIALGWKRGELQNLWARGEPERVCTH 327 >dbj|BAJ97624.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 554 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -2 Query: 455 GLLVTYLALNLMDGHGQPALLYIVPFMLGTLLTLGNKQRELENLWNKGEPERICQHE 285 GLL+TY+ALNLMDGHGQPALLYIVPF LGTL++LG K+ EL NLW KGEP+R+C H+ Sbjct: 471 GLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGEPDRVCTHQ 527 >dbj|BAK08187.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 554 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -2 Query: 455 GLLVTYLALNLMDGHGQPALLYIVPFMLGTLLTLGNKQRELENLWNKGEPERICQHE 285 GLL+TY+ALNLMDGHGQPALLYIVPF LGTL++LG K+ EL NLW KGEP+R+C H+ Sbjct: 471 GLLITYVALNLMDGHGQPALLYIVPFTLGTLISLGWKRGELRNLWLKGEPDRVCTHQ 527