BLASTX nr result
ID: Angelica22_contig00016426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00016426 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, p... 56 3e-06 >ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|222853663|gb|EEE91210.1| predicted protein [Populus trichocarpa] Length = 264 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +1 Query: 1 RWMIHLNQPDEVKVIQGSDHMTMFSKPQELSSFLLAIA 114 RWMI N PDEVKV+ GSDHM MFSKPQE+ S LL +A Sbjct: 223 RWMIEKNPPDEVKVVPGSDHMLMFSKPQEMCSCLLEVA 260 >ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538427|gb|EEF40033.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Length = 250 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +1 Query: 1 RWMIHLNQPDEVKVIQGSDHMTMFSKPQELSSFLLAIAQQ 120 RW+I N PDEVKVI SDHM MFSKPQEL S L IA++ Sbjct: 209 RWVIRTNPPDEVKVIPDSDHMVMFSKPQELCSCLEEIAKK 248