BLASTX nr result
ID: Angelica22_contig00016135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00016135 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB59354.1| peroxisome biogenesis factor 10 [Nicotiana tabacum] 80 1e-13 ref|XP_002308529.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 tpg|DAA41414.1| TPA: putative RING zinc finger domain superfamil... 78 7e-13 ref|XP_003559973.1| PREDICTED: peroxisome biogenesis factor 10-l... 78 7e-13 dbj|BAJ85007.1| predicted protein [Hordeum vulgare subsp. vulgare] 78 7e-13 >gb|ACB59354.1| peroxisome biogenesis factor 10 [Nicotiana tabacum] Length = 397 Score = 80.5 bits (197), Expect = 1e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 386 NCIMEWCNEKPECPLCRSPLTHSSLVCLYHSDF 288 NCIMEWCNEKPECPLCRSP+THSSLVCLYHSDF Sbjct: 365 NCIMEWCNEKPECPLCRSPITHSSLVCLYHSDF 397 >ref|XP_002308529.1| predicted protein [Populus trichocarpa] gi|222854505|gb|EEE92052.1| predicted protein [Populus trichocarpa] Length = 357 Score = 79.3 bits (194), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 386 NCIMEWCNEKPECPLCRSPLTHSSLVCLYHSDF 288 NCIMEWCNEKPECPLCR+P+THSSLVCLYHSDF Sbjct: 325 NCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF 357 >tpg|DAA41414.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 387 Score = 78.2 bits (191), Expect = 7e-13 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NCIMEWCNEKPECPLCRSPLTHSSLVCLYHSDF 288 NCIMEWCNEKPECPLCR+P+THSSL+C+YHSDF Sbjct: 355 NCIMEWCNEKPECPLCRTPITHSSLICIYHSDF 387 >ref|XP_003559973.1| PREDICTED: peroxisome biogenesis factor 10-like [Brachypodium distachyon] Length = 362 Score = 78.2 bits (191), Expect = 7e-13 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NCIMEWCNEKPECPLCRSPLTHSSLVCLYHSDF 288 NCIMEWCNEKPECPLCR+P+THSSL+C+YHSDF Sbjct: 330 NCIMEWCNEKPECPLCRTPITHSSLICIYHSDF 362 >dbj|BAJ85007.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 389 Score = 78.2 bits (191), Expect = 7e-13 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NCIMEWCNEKPECPLCRSPLTHSSLVCLYHSDF 288 NCIMEWCNEKPECPLCR+P+THSSL+C+YHSDF Sbjct: 357 NCIMEWCNEKPECPLCRTPITHSSLICIYHSDF 389