BLASTX nr result
ID: Angelica22_contig00015894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015894 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF88151.1|AC026234_2 Contains similarity to a rPOP protein f... 81 8e-14 ref|NP_173463.1| prolyl oligopeptidase-like protein [Arabidopsis... 81 8e-14 gb|AEX58649.1| prolyl oligopeptidase [Coffea arabica] gi|3719271... 81 8e-14 gb|AEX58648.1| prolyl oligopeptidase [Coffea arabica] 81 8e-14 ref|XP_002890385.1| hypothetical protein ARALYDRAFT_472267 [Arab... 81 1e-13 >gb|AAF88151.1|AC026234_2 Contains similarity to a rPOP protein from Rattus norvegicus gi|3043760 and is a member of the prolyl oligopeptidase family PF|00326. ESTs gb|AA651190, gb|H36145 come from this gene [Arabidopsis thaliana] Length = 739 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 2 VKFSGINWSHDNKGFFYYRFPAPKEGEKVDAGTETNANLNHQKFY 136 VKFSGI W+HD KGFFY R+PAP+EGEK+DAGTETN+NL H+ +Y Sbjct: 178 VKFSGITWTHDGKGFFYSRYPAPREGEKIDAGTETNSNLYHELYY 222 >ref|NP_173463.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi|332191846|gb|AEE29967.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] Length = 731 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 2 VKFSGINWSHDNKGFFYYRFPAPKEGEKVDAGTETNANLNHQKFY 136 VKFSGI W+HD KGFFY R+PAP+EGEK+DAGTETN+NL H+ +Y Sbjct: 178 VKFSGITWTHDGKGFFYSRYPAPREGEKIDAGTETNSNLYHELYY 222 >gb|AEX58649.1| prolyl oligopeptidase [Coffea arabica] gi|371927105|gb|AEX58650.1| prolyl oligopeptidase [Coffea arabica] Length = 731 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +2 Query: 2 VKFSGINWSHDNKGFFYYRFPAPKEGEKVDAGTETNANLNHQKFY 136 VKFS I+W+HD+KGFFY R+PAPKEG+ +DAGTETNANLNH+ +Y Sbjct: 178 VKFSNISWTHDSKGFFYSRYPAPKEGDNLDAGTETNANLNHELYY 222 >gb|AEX58648.1| prolyl oligopeptidase [Coffea arabica] Length = 731 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +2 Query: 2 VKFSGINWSHDNKGFFYYRFPAPKEGEKVDAGTETNANLNHQKFY 136 VKFS I+W+HD+KGFFY R+PAPKEG+ +DAGTETNANLNH+ +Y Sbjct: 178 VKFSNISWTHDSKGFFYSRYPAPKEGDNLDAGTETNANLNHELYY 222 >ref|XP_002890385.1| hypothetical protein ARALYDRAFT_472267 [Arabidopsis lyrata subsp. lyrata] gi|297336227|gb|EFH66644.1| hypothetical protein ARALYDRAFT_472267 [Arabidopsis lyrata subsp. lyrata] Length = 731 Score = 80.9 bits (198), Expect = 1e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 2 VKFSGINWSHDNKGFFYYRFPAPKEGEKVDAGTETNANLNHQKFY 136 VKFSGI W+HD KGFFY R+PAP+EGEK+DAGTETN+NL H+ +Y Sbjct: 178 VKFSGITWTHDGKGFFYSRYPAPQEGEKIDAGTETNSNLYHELYY 222