BLASTX nr result
ID: Angelica22_contig00015710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00015710 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34649.3| unnamed protein product [Vitis vinifera] 72 4e-11 ref|XP_002298026.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_002333746.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_002304505.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 gb|AFF18863.1| peptidase M1 family protein, partial [Dimocarpus ... 66 3e-09 >emb|CBI34649.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 72.0 bits (175), Expect(2) = 4e-11 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +2 Query: 89 SCRLICSVATES-PKQVEETTMDMPKEIFLKDYKSPDYYFDT 211 S R +CSVATES PKQVEE+ MDMPKEIFLKDYK PDYYFDT Sbjct: 74 SRRFVCSVATESSPKQVEESKMDMPKEIFLKDYKLPDYYFDT 115 Score = 20.4 bits (41), Expect(2) = 4e-11 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 7 LTSEVSNWRNSKFPYHS 57 L EVS+ RN +FP+ S Sbjct: 50 LNLEVSHRRNYRFPHPS 66 >ref|XP_002298026.1| predicted protein [Populus trichocarpa] gi|222845284|gb|EEE82831.1| predicted protein [Populus trichocarpa] Length = 918 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 77 DRRNSCRLICSVATES-PKQVEETTMDMPKEIFLKDYKSPDYYFDT 211 D+++ RLIC+VATE PKQVEE+ MD PKEIFLKDYK PDYYFD+ Sbjct: 11 DKQDRRRLICAVATEPLPKQVEESKMDAPKEIFLKDYKLPDYYFDS 56 >ref|XP_002333746.1| predicted protein [Populus trichocarpa] gi|222838415|gb|EEE76780.1| predicted protein [Populus trichocarpa] Length = 495 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 77 DRRNSCRLICSVATES-PKQVEETTMDMPKEIFLKDYKSPDYYFDT 211 D+++ RLIC+VATE PKQVEE+ MD PKEIFLKDYK PDYYFD+ Sbjct: 17 DKQDRKRLICAVATEPLPKQVEESKMDAPKEIFLKDYKLPDYYFDS 62 >ref|XP_002304505.1| predicted protein [Populus trichocarpa] gi|222841937|gb|EEE79484.1| predicted protein [Populus trichocarpa] Length = 950 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/52 (65%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 59 FLLI*SDRRNSCRLICSVATES-PKQVEETTMDMPKEIFLKDYKSPDYYFDT 211 FL D++ RLIC+VATE PKQVEE+ MD PKEIFLKD+K PDYYFD+ Sbjct: 38 FLSSERDKQGRRRLICAVATEPLPKQVEESKMDTPKEIFLKDHKLPDYYFDS 89 >gb|AFF18863.1| peptidase M1 family protein, partial [Dimocarpus longan] Length = 281 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = +2 Query: 95 RLICSVATES-PKQVEETTMDMPKEIFLKDYKSPDYYFD 208 RLICSVAT++ PKQVEE+ M+ PKEIFLKDYK PDYYFD Sbjct: 6 RLICSVATDNLPKQVEESKMEAPKEIFLKDYKMPDYYFD 44